DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303A1 and T19H12.12

DIOPT Version :9

Sequence 1:NP_001262470.1 Gene:Ugt303A1 / 53503 FlyBaseID:FBgn0040252 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001024147.2 Gene:T19H12.12 / 3565072 WormBaseID:WBGene00044282 Length:153 Species:Caenorhabditis elegans


Alignment Length:79 Identity:18/79 - (22%)
Similarity:33/79 - (41%) Gaps:18/79 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLTVLLFGLLCPKLTNAENILAVFSYTFGSSYL-LITPFLRNLVQRGHQLTLISAVTIMPHIEG 73
            :.|::|.|.....|       :.:|:..:|.|:: .|:.....:...||.:||...         
 Worm     7 IFLSILFFKCHSSK-------ILIFNPIYGFSHVKFISKVADIIADHGHHVTLFQP--------- 55

  Fly    74 VHHIRVPKLDMLMK 87
             :||.:..||.|:|
 Worm    56 -YHIALKNLDGLVK 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303A1NP_001262470.1 egt 26..465 CDD:223071 14/63 (22%)
UDPGT 39..507 CDD:278624 13/50 (26%)
T19H12.12NP_001024147.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.