DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and AT1G51210

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_175532.1 Gene:AT1G51210 / 841544 AraportID:AT1G51210 Length:433 Species:Arabidopsis thaliana


Alignment Length:343 Identity:72/343 - (20%)
Similarity:115/343 - (33%) Gaps:124/343 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LATGGGLTFITDMVGSPAPASFVPHIMLPFNDHMSLYERLLNVAFL-GYERVLLDYYFLPTQE-- 215
            :.|...|.:::.::.  |..|.|..:.|||..|..:...:.||..| ||...|:.......:|  
plant    52 IVTPKNLPYLSPLLS--AHPSAVSVVTLPFPHHPLIPSGVENVKDLGGYGNPLIMASLRQLREPI 114

  Fly   216 ------------KLYKEFFPG-------NKRCFYKMRRNASLVLINQHVS-------------LS 248
                        .|..:||.|       .:..|:.  ..|.|..|...||             ||
plant   115 VNWLSSHPNPPVALISDFFLGWTKDLGIPRFAFFS--SGAFLASILHFVSDKPHLFESTEPVCLS 177

  Fly   249 -------FPRPHSPNMIEVGGMHIDGKWNPLPEKIERF----INESEHGAIY------------- 289
                   |...|.|::|         ..:||.:.:|..    :|.|.:|.|:             
plant   178 DLPRSPVFKTEHLPSLI---------PQSPLSQDLESVKDSTMNFSSYGCIFNTCECLEEDYMEY 233

  Fly   290 ----------FSMG-------------SNLKTKDL-------PPSKV-------QEILK------ 311
                      |.:|             ||:..|.|       |...|       |::|.      
plant   234 VKQKVSENRVFGVGPLSSVGLSKEDSVSNVDAKALLSWLDGCPDDSVLYICFGSQKVLTKEQCDD 298

  Fly   312 -ALGGLKQ--RVLWKFELDNLPNKPEN------VYISDWFPQTDILAHPKIMAFVTHGGMLSTTE 367
             |||..|.  |.:|..:.|.:|:..|:      :.:..|.||..:|:|..:..|:.|.|..|..|
plant   299 LALGLEKSMTRFVWVVKKDPIPDGFEDRVAGRGMIVRGWAPQVAMLSHVAVGGFLIHCGWNSVLE 363

  Fly   368 SIYHAKPVIGLPIFSDQF 385
            ::.....::..|:.:|||
plant   364 AMASGTMILAWPMEADQF 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 72/343 (21%)
AT1G51210NP_175532.1 Glycosyltransferase_GTB-type 18..432 CDD:385653 72/343 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.