DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and UGT78D1

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_564357.1 Gene:UGT78D1 / 839933 AraportID:AT1G30530 Length:453 Species:Arabidopsis thaliana


Alignment Length:327 Identity:69/327 - (21%)
Similarity:116/327 - (35%) Gaps:95/327 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LAEHFNAPLIGLATGGGLTFITDMVGSPAPASFVPHIMLPFNDHMSLYERLLNVAFLGYERVLLD 207
            :|...||..:....||.             .|...|:      :..|....:.:..:..|..|  
plant   128 IAAELNATWVAFWAGGA-------------NSLCAHL------YTDLIRETIGLKDVSMEETL-- 171

  Fly   208 YYFLP----------TQEKLYKEF---FPGNKRCFYKMRRNASLVLINQHVSLSFPRPHSPNMIE 259
             .|:|          .:|.::::.   ||   :..|:|             ||:.||..:..:..
plant   172 -GFIPGMENYRVKDIPEEVVFEDLDSVFP---KALYQM-------------SLALPRASAVFISS 219

  Fly   260 VGGMHIDGKWNPLPEKIERFIN-----------ESE----HGAI------------YFSMGSNLK 297
            ...:.....:| |..|::||:|           |.|    ||..            |.|.|:.::
plant   220 FEELEPTLNYN-LRSKLKRFLNIAPLTLLSSTSEKEMRDPHGCFAWMGKRSAASVAYISFGTVME 283

  Fly   298 TKDLPPSKVQEILKALGGLKQRVLWKFELDNLPNKP--------ENVYISDWFPQTDILAHPKIM 354
            .   ||.::..|.:.|...|...:|..:..|:.:.|        |...:..|.||.::|.|..:.
plant   284 P---PPEELVAIAQGLESSKVPFVWSLKEKNMVHLPKGFLDRTREQGIVVPWAPQVELLKHEAMG 345

  Fly   355 AFVTHGGMLSTTESIYHAKPVIGLPIFSDQFFNMAHAEQN-GYGIMLDFKTLNAVEFRKAIERIT 418
            ..|||.|..|..||:....|:||.||.:|...|....|.. ..|:|:|    |.|..::..|:..
plant   346 VNVTHCGWNSVLESVSAGVPMIGRPILADNRLNGRAVEVVWKVGVMMD----NGVFTKEGFEKCL 406

  Fly   419 SE 420
            ::
plant   407 ND 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 69/327 (21%)
UGT78D1NP_564357.1 GT1_Gtf-like 12..432 CDD:340817 69/327 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.