DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and UGT85A5

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_973885.1 Gene:UGT85A5 / 838844 AraportID:AT1G22370 Length:479 Species:Arabidopsis thaliana


Alignment Length:461 Identity:84/461 - (18%)
Similarity:160/461 - (34%) Gaps:142/461 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LCSLGYSSGYN-YLMVLNSAGRSHFNVGHALAKGLVKAGHTITVVS-------VFPQKKP----- 62
            :.|...:||.. :::.:....:.|.|....:||.|...|..:|.|:       :...:.|     
plant     1 MASHAVTSGQKPHVVCIPFPAQGHINPMLKVAKLLYARGFHVTFVNTNYNHNRLIRSRGPNSLDG 65

  Fly    63 IPGYTDVSVPNVI-----EVMGGDIGALWASIQKTYTQNLIDHYQMGFRITRGLFEDSNFQDFLK 122
            :|.:...|:|:.:     :|| .|:..|..|..|    |.:                :.|::.|:
plant    66 LPSFRFESIPDGLPEENKDVM-QDVPTLCESTMK----NCL----------------APFKELLR 109

  Fly   123 S-NQSFDAIICETFYNDAHYGLAEHFNAPLIGLATGGGLTFITD----------MVGSPAPASFV 176
            . |.:.|.                   .|:..:.:.|.::|..|          :..:|:...|:
plant   110 RINTTKDV-------------------PPVSCIVSDGVMSFTLDAAEELGVPDVLFWTPSACGFL 155

  Fly   177 PHI---------MLPFNDHMSLYERLLNVAFLGYERVLLDYYFLPTQEKLYKEFFPGNKRC---- 228
            .::         :.|..|..||..::               .::|:.:.|..:..|...|.    
plant   156 AYLHFYRFIEKGLSPIKDESSLDTKI---------------NWIPSMKNLGLKDIPSFIRATNTE 205

  Fly   229 -----FY----KMRRNASLVLINQHVSLSFPRPHS-----PNMIEVGGMHI-------------- 265
                 |:    ...:.||.:::|...||......|     |.:..:|.:|:              
plant   206 DIMLNFFVHEADRAKRASAIILNTFDSLEHDVVRSIQSIIPQVYTIGPLHLFVNRDIDEESDIGQ 270

  Fly   266 --DGKWNPLPEKIERFINESEHGAIYFSMGSNLKTKDLPPSKVQEILKALGGLKQRVLWKFELD- 327
              ...|....|.::....:|.:..:|.:.||   ...:...::.|....|...|:..||....| 
plant   271 IGTNMWREEMECLDWLDTKSPNSVVYVNFGS---ITVMSAKQLVEFAWGLAATKKDFLWVIRPDL 332

  Fly   328 ---NLPNKPENVYI--------SDWFPQTDILAHPKIMAFVTHGGMLSTTESIYHAKPVIGLPIF 381
               ::|..|.:..|        :.|.||..:|:||.:..|:||.|..||.||:....|::..|.|
plant   333 VAGDVPMLPPDFLIETANRRMLASWCPQEKVLSHPAVGGFLTHSGWNSTLESLSGGVPMVCWPFF 397

  Fly   382 SDQFFN 387
            ::|..|
plant   398 AEQQTN 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 84/461 (18%)
UGT85A5NP_973885.1 Glycosyltransferase_GTB-type 12..475 CDD:385653 81/450 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.