DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and AT5G65550

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_201358.1 Gene:AT5G65550 / 836681 AraportID:AT5G65550 Length:466 Species:Arabidopsis thaliana


Alignment Length:425 Identity:85/425 - (20%)
Similarity:153/425 - (36%) Gaps:134/425 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VGH-----ALAKGLVKAGHTITVVSVFPQKKPIPGYTDVS-VPNVIEVMGGDIGALWASIQKTYT 94
            :||     .|:|.:.:.|||::.:|.         ..::| :||:    ..|:...:.|:..:.|
plant    18 LGHMIPYLQLSKLIARKGHTVSFIST---------ARNISRLPNI----SSDLSVNFVSLPLSQT 69

  Fly    95 QNLIDHYQMGFRITR---------------GLFEDSNFQDFLKSNQSFDAIICETFYNDAHYGLA 144
               :||.......|.               ||.|  .|.:||::::.          |...|.:.
plant    70 ---VDHLPENAEATTDVPETHIAYLKKAFDGLSE--AFTEFLEASKP----------NWIVYDIL 119

  Fly   145 EHFNAPL---IGLATGGGLTFITD---MVGSPAPASFVPHIMLPFNDHMSLYERLL--------- 194
            .|:..|:   :|:......||...   ::|.||      .:|:..:|.....|.|:         
plant   120 HHWVPPIAEKLGVRRAIFCTFNAASIIIIGGPA------SVMIQGHDPRKTAEDLIVPPPWVPFE 178

  Fly   195 -NVAFLGYE-RVLLDYYFLPTQEKLYKEFFPGNKRCFYKMRRNASLVLI--------NQHVSLSF 249
             |:.:..:| :.:::|   ||......|.   |..|...:....|.|::        .:.:.|..
plant   179 TNIVYRLFEAKRIMEY---PTAGVTGVEL---NDNCRLGLAYVGSEVIVIRSCMELEPEWIQLLS 237

  Fly   250 PRPHSPNMIEVGGMHI--------DGKWNPLPEKIERFINESEHGAIYFSMGSNLKTKDLPPSKV 306
            .....| :|.:|.:..        :|.|..:.|.::|...:|   .:|.::|:.:...:   .::
plant   238 KLQGKP-VIPIGLLPATPMDDADDEGTWLDIREWLDRHQAKS---VVYVALGTEVTISN---EEI 295

  Fly   307 QEILKAL----------------------GGLKQRVLWKFELDNLPNKPENVYISDWFPQTDILA 349
            |.:...|                      .|.|:||           |...|..::|.|||.||:
plant   296 QGLAHGLELCRLPFFWTLRKRTRASMLLPDGFKERV-----------KERGVIWTEWVPQTKILS 349

  Fly   350 HPKIMAFVTHGGMLSTTESIYHAKPVIGLPIFSDQ 384
            |..:..||||.|..|..|.:....|:|..|...||
plant   350 HGSVGGFVTHCGWGSAVEGLSFGVPLIMFPCNLDQ 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 85/425 (20%)
AT5G65550NP_201358.1 Glycosyltransferase_GTB-type 7..461 CDD:385653 85/425 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.