DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and UGT76E2

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_200767.1 Gene:UGT76E2 / 836078 AraportID:AT5G59590 Length:449 Species:Arabidopsis thaliana


Alignment Length:487 Identity:107/487 - (21%)
Similarity:163/487 - (33%) Gaps:144/487 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GHA-----LAKGLVKAGHTITVVSVFPQKKPIPGYTDVSVPNVIEVMGGDIGALWASIQKTYTQN 96
            ||.     |.|.|...|.:|||  |..|...:....|.|..:.:.:.|        |:.::..||
plant    20 GHVTPMMQLGKALHSKGFSITV--VLTQSNRVSSSKDFSDFHFLTIPG--------SLTESDLQN 74

  Fly    97 LIDHYQMGFRITRGLFEDSNFQDFL------KSNQSFDAIICETFYNDAHYGLAEHFNAPLIGLA 155
            |   ....|.:......:::|:..:      :.|.....::.:.:...:|..:.| |..|.:..:
plant    75 L---GPQKFVLKLNQICEASFKQCIGQLLHEQCNNDIACVVYDEYMYFSHAAVKE-FQLPSVVFS 135

  Fly   156 TGGGLTFITDMVGSPAPASFVPHIMLPFNDHMSLYERLLNVAFLGYERVLLDYYFLPTQEKLYKE 220
            |.....|:...|.|...|                            |..|:|.....||:|:   
plant   136 TTSATAFVCRSVLSRVNA----------------------------ESFLIDMKDPETQDKV--- 169

  Fly   221 FFPGNKRCFYK---------------------MRRNASLVLINQHVSL---SFPRPHSPNMIEV- 260
             |||.....||                     ..|.||.|:||....|   |..|......:.| 
plant   170 -FPGLHPLRYKDLPTSVFGPIESTLKVYSETVNTRTASAVIINSASCLESSSLARLQQQLQVPVY 233

  Fly   261 --GGMHIDGKW-NPLPEK----IERFINESEHGAIYFSMGS--NLKTKDLPPSKVQEILKALGGL 316
              |.:||.... :.|.|:    :|....:..:..||.|:||  .:.|||:     .|:...|...
plant   234 PIGPLHITASAPSSLLEEDRSCVEWLNKQKSNSVIYISLGSLALMDTKDM-----LEMAWGLSNS 293

  Fly   317 KQRVLWKFELDNLPNK------PENV--------YISDWFPQTDILAHPKIMAFVTHGGMLSTTE 367
            .|..||.....::|..      ||..        ||..|.||.::|.||.:..|.:|.|..||.|
plant   294 NQPFLWVVRPGSIPGSEWTESLPEEFNRLVSERGYIVKWAPQMEVLRHPAVGGFWSHCGWNSTVE 358

  Fly   368 SIYHAKPVIGLPIFSDQFFNMAHAEQNGYGIMLDFKTLNAVEFRKAIERITSEPSYTKVVQGISF 432
            ||....|:|..|...||..|..:.|:                    :.||           |:..
plant   359 SIGEGVPMICRPFTGDQKVNARYLER--------------------VWRI-----------GVQL 392

  Fly   433 RYRDQQQTPIENAIYWVEHVTRHQGAAYLKSA 464
            . .|..:..:|.|:.|:  :...:||...|.|
plant   393 E-GDLDKETVERAVEWL--LVDEEGAEMRKRA 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 107/487 (22%)
UGT76E2NP_200767.1 Glycosyltransferase_GTB-type 1..449 CDD:415824 107/487 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.