DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and AT5G38010

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_198617.1 Gene:AT5G38010 / 833780 AraportID:AT5G38010 Length:453 Species:Arabidopsis thaliana


Alignment Length:419 Identity:93/419 - (22%)
Similarity:147/419 - (35%) Gaps:91/419 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LMVLNSAGRSHFNVGHALAKGLVKAGHTITVVSV-FPQKKPIPGYTD---VSVPNVIEVMG-GDI 82
            ::::.:..:.|.:....||:.|...|.:|||... |...||.....|   :::|..:.... .::
plant    11 IVLIPAPAQGHISPMMQLARALHLKGFSITVAQTKFNYLKPSKDLADFQFITIPESLPASDLKNL 75

  Fly    83 GALWASIQKTYTQNLIDHYQMGFRITRGLFEDSNFQDFLKSNQSF--DAIICETFYNDAHY---G 142
            |.:|      :...|....:..|:...|        ..|...|..  :.|.| ..|::..|   .
plant    76 GPVW------FLLKLNKECEFSFKECLG--------QLLLQKQLIPEEEIAC-VIYDEFMYFAEA 125

  Fly   143 LAEHFNAPLIGLATGGGLTFITDMV---------------GSPAPASFVPHIMLPFNDHMSLYER 192
            .|:.||.|.:..:|.....|.....               |.......||.:      |...|:.
plant   126 AAKEFNLPKVIFSTENATAFACRSAMCKLYAKDGLAPLKEGCGREEELVPKL------HPLRYKD 184

  Fly   193 LLNVAFLGYERVLLDYYFLPTQEKLYKEFFPGNKRCFYKMRRNASLVLINQHVSLSFPRPHSPNM 257
            |...||...| ..::.:.....:...........||.    ..:||..:.|.:.:    |..|  
plant   185 LPTSAFAPVE-ASVEVFKSSCDKGTASAMIINTVRCL----EISSLEWLQQELKI----PIYP-- 238

  Fly   258 IEVGGMHIDGKWNP---LPEK---IERFINESEHGAIYFSMGS--NLKTKDLPPSKVQEILKALG 314
              :|.:|:.....|   |.|.   |:....:.....||.|:||  .|:||        |:|:...
plant   239 --IGPLHMVSSAPPTSLLDENESCIDWLNKQKPSSVIYISLGSFTLLETK--------EVLEMAS 293

  Fly   315 GL---KQRVLWKF-------------ELDNLPNKPENVYISDWFPQTDILAHPKIMAFVTHGGML 363
            ||   .|..||..             ||.::...|:..||..|.||..:|||..:.||.:|.|..
plant   294 GLVSSNQHFLWVIRPGSILGSELTNEELLSMMEIPDRGYIVKWAPQKQVLAHSAVGAFWSHCGWN 358

  Fly   364 STTESIYHAKPVIGLPIFSDQFFNMAHAE 392
            ||.||:....|:|..|..:||..|..:.|
plant   359 STLESMGEGVPMICRPFTTDQKVNARYVE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 93/419 (22%)
AT5G38010NP_198617.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 93/419 (22%)
YjiC 8..433 CDD:224732 93/419 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.