DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:403 Identity:85/403 - (21%)
Similarity:136/403 - (33%) Gaps:116/403 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRSHFNVGHALAKGLVKAGHTITVVSVFPQKKPIPGYTDVSVPNVIEVMG-GDIGALWASIQKTY 93
            ||:|...|.::.....|..:       ....|.:..:..:::|..:.... ..:|.:|..|:   
plant     5 GRAHSLKGFSITVAQTKFNY-------LNPSKDLADFQFITIPESLPASDLKTLGPIWFIIK--- 59

  Fly    94 TQNLIDHYQMGFRITRGLFEDSNFQDFLKSNQSFDAIICETFYNDAHYGLAEHFNAPLIGLATGG 158
               |....::.|:...|.|       .|:..:....:|.:.|...|. ..|:.||.|.:..:|..
plant    60 ---LNKECEISFKKCLGQF-------LLQQQEEIACVIYDEFMYFAE-AAAKEFNLPKVIFSTEN 113

  Fly   159 GLTF-----------------ITDMVGSPAPASFVPHIMLPFNDHMSLYERLLNVAFLGYERVLL 206
            ...|                 :|:  |.......||.:      |...|:.|...||...|..: 
plant   114 ATAFACRSAMCKLYAKDGIAPLTE--GCGREEELVPEL------HPLRYKDLPTSAFAPVEASV- 169

  Fly   207 DYYFLPTQEKLYKEFFPGNKRCFYKMRRNASLVLINQ------------HVSLSFPRPHSPNMIE 259
                         |.|..:  |   .:..||.::||.            ...|..|      :..
plant   170 -------------EVFKSS--C---EKGTASSMIINTVSCLEISSLEWLQQELKIP------IYP 210

  Fly   260 VGGMHIDGKWNP---LPEK---IERFINESEHGAIYFSMGS--NLKTKDLPPSKVQEILKALGGL 316
            :|.:::.....|   |.|.   |:....:.....||.|:||  .|:||        |:|:...||
plant   211 IGPLYMVSSAPPTSLLDENESCIDWLNKQKPSSVIYISLGSFTLLETK--------EVLEMASGL 267

  Fly   317 ---KQRVLWKF-------------ELDNLPNKPENVYISDWFPQTDILAHPKIMAFVTHGGMLST 365
               .|..||..             ||.::...|:..||..|..|..:|||..:.||.:|.|..||
plant   268 VSSNQYFLWAIRPGSILGSELSNEELFSMMEIPDRGYIVKWATQKQVLAHAAVGAFWSHCGWNST 332

  Fly   366 TESIYHAKPVIGL 378
            .|||....|::||
plant   333 LESIGEGIPIVGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 85/403 (21%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 83/399 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.