DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and AT5G03490

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_195969.1 Gene:AT5G03490 / 831823 AraportID:AT5G03490 Length:465 Species:Arabidopsis thaliana


Alignment Length:356 Identity:77/356 - (21%)
Similarity:121/356 - (33%) Gaps:129/356 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 FNAPLIGLATGGGLTFITDMVGSPAPASFVPHIMLPFNDHMSLYERLLNVA-------------- 197
            ||..:|  .|.|.||:::.:: |..|:| |..::.||..|.||...:.||.              
plant    46 FNVSVI--VTPGNLTYLSPLL-SAHPSS-VTSVVFPFPPHPSLSPGVENVKDVGNSGNLPIMASL 106

  Fly   198 -------------------------FLGYERVLLDYYFLPTQEKLYKEFFPGN--KRCFYKMRRN 235
                                     |||:...|.:...:|........||..:  :.||    .|
plant   107 RQLREPIINWFQSHPNPPIALISDFFLGWTHDLCNQIGIPRFAFFSISFFLVSVLQFCF----EN 167

  Fly   236 ASLVLINQHVSL-------SFPRPHSPNMIEVGGMHIDGKWNPLP--EKIERF----------IN 281
            ..|:.....:.|       .|...|.|:::.      .....|.|  |.|:.|          .|
plant   168 IDLIKSTDPIHLLDLPRAPIFKEEHLPSIVR------RSLQTPSPDLESIKDFSMNLLSYGSVFN 226

  Fly   282 ESE---------------HGAIYF-----SMGSNLKTK--DLPPSKVQ--------EIL------ 310
            .||               |..:|.     |:||.||:.  .:.||.:.        .:|      
plant   227 SSEILEDDYLQYVKQRMGHDRVYVIGPLCSIGSGLKSNSGSVDPSLLSWLDGSPNGSVLYVCFGS 291

  Fly   311 -KALG---------GLKQ---RVLWKFELDNLPNKPEN------VYISDWFPQTDILAHPKIMAF 356
             |||.         ||::   |.:|..:.|.:|:..|:      :.:..|..|..:|.|..:..|
plant   292 QKALTKDQCDALALGLEKSMTRFVWVVKKDPIPDGFEDRVSGRGLVVRGWVSQLAVLRHVAVGGF 356

  Fly   357 VTHGGMLSTTESIYHAKPVIGLPIFSDQFFN 387
            ::|.|..|..|.|.....::|.|:.:|||.|
plant   357 LSHCGWNSVLEGITSGAVILGWPMEADQFVN 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 77/356 (22%)
AT5G03490NP_195969.1 Glycosyltransferase_GTB_type 19..460 CDD:299143 77/356 (22%)
YjiC 19..447 CDD:224732 77/356 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.