DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and UGT78D2

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:362 Identity:77/362 - (21%)
Similarity:120/362 - (33%) Gaps:115/362 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 LAEHFNAPLIGLATGGGLTFITDMVGSPAPASFVPHIMLPFNDHMSLYERLLNVAFLGYERVLLD 207
            :|...||..|...|.|.             .|...|:      :..|....:.|..:| ||:...
plant   132 MATEINASWIAFWTAGA-------------NSLSAHL------YTDLIRETIGVKEVG-ERMEET 176

  Fly   208 YYFLPTQEKLYKEFFP-----GN-KRCFYKMRR-------NASLVLINQHVSLSFPRPHSPNMIE 259
            ...:...||:..:..|     || ...|.||..       .|:.|.||....|      .|.:. 
plant   177 IGVISGMEKIRVKDTPEGVVFGNLDSVFSKMLHQMGLALPRATAVFINSFEDL------DPTLT- 234

  Fly   260 VGGMHIDGKWNPLPEKIERFIN---------------ESEHGAI------------YFSMGSNLK 297
                      |.|..:.:|::|               :..||.:            |.|.|:.:.
plant   235 ----------NNLRSRFKRYLNIGPLGLLSSTLQQLVQDPHGCLAWMEKRSSGSVAYISFGTVMT 289

  Fly   298 TKDLPPSKVQEILKALGGLKQRVLWKFELDNLPNKP--------ENVYISDWFPQTDILAHPKIM 354
            .   ||.::..|.:.|...|...:|..:..:|...|        |...:..|.||.::|.|....
plant   290 P---PPGELAAIAEGLESSKVPFVWSLKEKSLVQLPKGFLDRTREQGIVVPWAPQVELLKHEATG 351

  Fly   355 AFVTHGGMLSTTESIYHAKPVIGLPIFSDQFFNMAHAE---------------QNGYGIMLDFKT 404
            .||||.|..|..||:....|:|..|.|.||..|....|               ::|:...|| |.
plant   352 VFVTHCGWNSVLESVSGGVPMICRPFFGDQRLNGRAVEVVWEIGMTIINGVFTKDGFEKCLD-KV 415

  Fly   405 L----------NAVEFRK-AIERITSEPSYTKVVQGI 430
            |          ||.:.:: |.|.::|:...::..:|:
plant   416 LVQDDGKKMKCNAKKLKELAYEAVSSKGRSSENFRGL 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 77/362 (21%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 74/346 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.