DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and AT5G17040

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_197206.2 Gene:AT5G17040 / 831567 AraportID:AT5G17040 Length:442 Species:Arabidopsis thaliana


Alignment Length:144 Identity:35/144 - (24%)
Similarity:60/144 - (41%) Gaps:12/144 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 SEHGAIYFSMGSNLKTKDLPPSKVQEILKALGGLKQRVLWKFELDNLPNKP--------ENVYIS 339
            |....:|.:.|   :....||.::..:.:.|...|...:|..:..|:.:.|        |...:.
plant   258 STASVVYIAFG---RVMTPPPGELVVVAQGLESSKVPFVWSLQEKNMVHLPKGFLDGTREQGMVV 319

  Fly   340 DWFPQTDILAHPKIMAFVTHGGMLSTTESIYHAKPVIGLPIFSDQFFNMAHAEQN-GYGIMLDFK 403
            .|.||.::|.|..:..||:|||..|..||:....|:|..|||.|...|....|.. ..|:.:...
plant   320 PWAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHALNARSVEAVWEIGMTISSG 384

  Fly   404 TLNAVEFRKAIERI 417
            ......|.::::|:
plant   385 VFTKDGFEESLDRV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 35/144 (24%)
AT5G17040NP_197206.2 Glycosyltransferase_GTB_type 2..428 CDD:299143 35/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.