DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and UGT76C1

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_196206.1 Gene:UGT76C1 / 830472 AraportID:AT5G05870 Length:464 Species:Arabidopsis thaliana


Alignment Length:504 Identity:107/504 - (21%)
Similarity:172/504 - (34%) Gaps:168/504 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LAKGLVKAGHTITVVSV---FPQKKPIPGYTDVSVPNVIEVMGGDIGALWASIQKTYTQNLI--- 98
            |||.|...|.:||::..   .|:....|.:|      .:::..|      .|..:|.:::|:   
plant    26 LAKILYSRGFSITIIHTRFNAPKSSDHPLFT------FLQIRDG------LSESQTQSRDLLLQL 78

  Fly    99 ----DHYQMGFRITRGLF----EDSNFQDFLKSNQSFDAIICETFYNDAHY----GLAEHFNAPL 151
                ::.|:.||......    .||..:|     :....:|     :|:.:    .:||.||.|.
plant    79 TLLNNNCQIPFRECLAKLIKPSSDSGTED-----RKISCVI-----DDSGWVFTQSVAESFNLPR 133

  Fly   152 IGLATGGGLTFITDMVGSPAPASFVPHIMLPFNDHMSLYERLLNVAFLGYERVLLDYYFLPTQE- 215
            ..|.   ...|          :.|:.|.::|         ::....||.          :|..| 
plant   134 FVLC---AYKF----------SFFLGHFLVP---------QIRREGFLP----------VPDSEA 166

  Fly   216 -KLYKEFFPGNKRCFYKM--------------------RRNASLVLIN-----QHVSLS-----F 249
             .|..||.|..|:...::                    .:.||.:::.     .|.||:     |
plant   167 DDLVPEFPPLRKKDLSRIMGTSAQSKPLDAYLLKILDATKPASGIIVMSCKELDHDSLAESNKVF 231

  Fly   250 PRPHSPNMIEVGGMHIDGKWNPLPEKIERFINESE-----------HGAIYFSMGSNLKTKDLPP 303
            ..|..|    :|..||    :.:|......:...:           ...:|.|:||   ...|..
plant   232 SIPIFP----IGPFHI----HDVPASSSSLLEPDQSCIPWLDMRETRSVVYVSLGS---IASLNE 285

  Fly   304 SKVQEILKALGGLKQRVLWKFELDNLPNKPENVYISDWF---------------------PQTDI 347
            |...||...|....|..||..       :|.:|:..||.                     ||.|:
plant   286 SDFLEIACGLRNTNQSFLWVV-------RPGSVHGRDWIESLPSGFMESLDGKGKIVRWAPQLDV 343

  Fly   348 LAHPKIMAFVTHGGMLSTTESIYHAKPVIGLPIFSDQFFNMAH-AEQNGYGIMLDFKTLNAVEFR 411
            |||.....|:||.|..||.|||....|:|.||...|||.|... :|....||.|:.: :...|..
plant   344 LAHRATGGFLTHNGWNSTLESICEGVPMICLPCKWDQFVNARFISEVWRVGIHLEGR-IERREIE 407

  Fly   412 KAIERITSEPSYTKVVQGISFRYRDQQQTPIENAIYWVEHVTRHQGAAY 460
            :|:.|:..| |..:.::|.....||:           |....:..|::|
plant   408 RAVIRLMVE-SKGEEIRGRIKVLRDE-----------VRRSVKQGGSSY 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 107/504 (21%)
UGT76C1NP_196206.1 Glycosyltransferase_GTB_type 2..451 CDD:299143 107/504 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.