DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and AT3G55710

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_191130.1 Gene:AT3G55710 / 824737 AraportID:AT3G55710 Length:464 Species:Arabidopsis thaliana


Alignment Length:522 Identity:107/522 - (20%)
Similarity:169/522 - (32%) Gaps:172/522 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HFNVGHALAKGLVKAGHTITVVSV---FPQKKPIPGYTDVSVPNVIE-----------VMGGDIG 83
            |||....||......|.::|::..   ||.....|.:|..::.:..|           ..|.|:.
plant    19 HFNPMIELAGIFHNRGFSVTILHTSFNFPDPSRHPQFTFRTITHKNEGEEDPLSQSETSSGKDLV 83

  Fly    84 ALWASIQKTYTQ-NLIDHYQMGFRITRGLFEDSNFQDFLKSNQSFDAIICETFYNDAHYGLAEHF 147
            .|.:.:::.||: :|.:....|                        ..:| ...:||.:|.....
plant    84 VLISLLKQYYTEPSLAEEVGEG------------------------GTVC-CLVSDALWGRNTEI 123

  Fly   148 NAPLIGLATGGGLTFITDMVGSPAPASFVPHIMLPFNDHMSLYERLLNVAFLGYERVLLDYYFLP 212
            .|..||:.        |.::.:...|:|..:...|                     :|:|..:||
plant   124 VAKEIGVC--------TMVMRTSGAATFCAYTAFP---------------------LLIDKGYLP 159

  Fly   213 TQ----EKLYKEFFP---------------GNKRCFYKMRRNASL---------------VLINQ 243
            .|    ::|..|..|               |..|....|...|.|               .|::.
plant   160 IQGSRLDELVTELPPLKVKDLPVIKTKEPEGLNRILNDMVEGAKLSSGVVWNTFEDLERHSLMDC 224

  Fly   244 HVSLSFPRPHSPNMIEVGGMHIDGKWNPLPEK-----------IERFIN-ESEHGAIYFSMGSNL 296
            ...|..|      :..:|..|  .....||.|           :..::| ::....:|.|.||  
plant   225 RSKLQVP------LFPIGPFH--KHRTDLPPKPKNKDKDDDEILTDWLNKQAPQSVVYVSFGS-- 279

  Fly   297 KTKDLPPSKVQEILKALGGLKQR---VLWKFE---------LDNLP-NKPENV----YISDWFPQ 344
                |...:..|..:...||:..   .||...         |::|| ...||:    .|..|..|
plant   280 ----LAAIEENEFFEIAWGLRNSELPFLWVVRPGMVRGTEWLESLPCGFLENIGHQGKIVKWVNQ 340

  Fly   345 TDILAHPKIMAFVTHGGMLSTTESIYHAKPVIGLPIFSDQFFNMAH-AEQNGYGIMLDFKTLNAV 408
            .:.||||.:.||.||.|..||.|||....|:|..|.||||..|..: .:....|:||:...:...
plant   341 LETLAHPAVGAFWTHCGWNSTIESICEGVPMICTPCFSDQHVNARYIVDVWRVGMMLERCKMERT 405

  Fly   409 EFRKAIERITSE--PSYTKVV-------------QGISFRYRDQQQTPIENAIYWVEHVTRHQGA 458
            |..|.:..:..|  ...|::.             .|.|.:|.|:          .|.||.....:
plant   406 EIEKVVTSVMMENGAGLTEMCLELKEKANVCLSEDGSSSKYLDK----------LVSHVLSFDSS 460

  Fly   459 AY 460
            |:
plant   461 AF 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 107/522 (20%)
AT3G55710NP_191130.1 Glycosyltransferase_GTB_type 1..454 CDD:299143 104/512 (20%)
YjiC 7..421 CDD:224732 98/469 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.