DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and AT3G22250

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_188864.1 Gene:AT3G22250 / 821795 AraportID:AT3G22250 Length:461 Species:Arabidopsis thaliana


Alignment Length:225 Identity:49/225 - (21%)
Similarity:83/225 - (36%) Gaps:65/225 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 SPNMIEVGGMHIDGKWNPLPEKIERFINE-----------SEHGAIYFSMGSNLKTKDLPPSKVQ 307
            :|.::.:|.:|.....|.:......|..|           :.:..||.|.||  ....:..|.:|
plant   241 NPQILHLGPLHNQEATNNITITKTSFWEEDMSCLGWLQEQNPNSVIYISFGS--WVSPIGESNIQ 303

  Fly   308 EILKALGGLKQRVLWKFE---LDNLPNKPENVY----------ISDWFPQTDILAHPKIMAFVTH 359
            .:..||....:..||...   .:.||  |..|:          |..|.||.::|.:..:..:|||
plant   304 TLALALEASGRPFLWALNRVWQEGLP--PGFVHRVTITKNQGRIVSWAPQLEVLRNDSVGCYVTH 366

  Fly   360 GGMLSTTESIYHAKPVIGLPIFSDQFFNMAH--------AEQNGYGIMLDFKTLNAVE--FRKAI 414
            .|..||.|::..::.::..|:..|||.|..:        ...:|:|       ...||  .||.:
plant   367 CGWNSTMEAVASSRRLLCYPVAGDQFVNCKYIVDVWKIGVRLSGFG-------EKEVEDGLRKVM 424

  Fly   415 E--------------------RITSEPSYT 424
            |                    |::||.::|
plant   425 EDQDMGERLRKLRDRAMGNEARLSSEMNFT 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 49/225 (22%)
AT3G22250NP_188864.1 PLN02562 1..461 CDD:215305 49/225 (22%)
YjiC 6..445 CDD:224732 45/214 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.