DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and AT2G31790

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_180738.1 Gene:AT2G31790 / 817736 AraportID:AT2G31790 Length:457 Species:Arabidopsis thaliana


Alignment Length:167 Identity:40/167 - (23%)
Similarity:73/167 - (43%) Gaps:33/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 NESEHGAIYFSMGSNLKTKDLPPSKVQEILKALGGLKQRVLW---KFELDNLPN-------KPEN 335
            |......:|.:.|:.:.   |...:::||..|:.......||   :.|...||:       :.::
plant   268 NRPAKSVVYVAFGTLVA---LSEKQMKEIAMAISQTGYHFLWSVRESERSKLPSGFIEEAEEKDS 329

  Fly   336 VYISDWFPQTDILAHPKIMAFVTHGGMLSTTESIYHAKPVIGLPIFSDQFFNMAHAE---QNGYG 397
            ..::.|.||.::|||..|..||:|.|..||.|::....|::|:|.::||..|....|   :.|..
plant   330 GLVAKWVPQLEVLAHESIGCFVSHCGWNSTLEALCLGVPMVGVPQWTDQPTNAKFIEDVWKIGVR 394

  Fly   398 IMLDFKTLNA-----------------VEFRKAIERI 417
            :..|.:.|::                 .|.||.:|::
plant   395 VRTDGEGLSSKEEIARCIVEVMEGERGKEIRKNVEKL 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 40/167 (24%)
AT2G31790NP_180738.1 Glycosyltransferase_GTB_type 3..454 CDD:299143 40/167 (24%)
YjiC 6..454 CDD:224732 40/167 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.