DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and UGT74D1

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001325305.1 Gene:UGT74D1 / 817732 AraportID:AT2G31750 Length:490 Species:Arabidopsis thaliana


Alignment Length:435 Identity:93/435 - (21%)
Similarity:150/435 - (34%) Gaps:126/435 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ITRGLFEDSNFQDFLKSNQSFDAIICETFYNDA---HYGLA--------EHFNAPLIGLATGGGL 160
            ::|.|.|..:..|...:...:|:  |..:..|.   |.|:|        ...||..|....|...
plant    93 VSRSLSELISSMDPKPNAVVYDS--CLPYVLDVCRKHPGVAAASFFTQSSTVNATYIHFLRGEFK 155

  Fly   161 TFITDMV---GSPAPASFVPHIMLPFNDHMSLYERLLNVAFLGYERVLLDYYFLPTQEKLYKEFF 222
            .|..|:|   ..|...:.:|..:...|....|:| |::..|:..:.:  |::.:.:.::|..|  
plant   156 EFQNDVVLPAMPPLKGNDLPVFLYDNNLCRPLFE-LISSQFVNVDDI--DFFLVNSFDELEVE-- 215

  Fly   223 PGNKRCFYKMRRNASLVLINQHVSLSFPRPHSPNMIEVGGMHIDGKWNPLPEKIERFINESEHG- 286
                              :.|.:...:|..:...||.  .|::|          :|...:.::| 
plant   216 ------------------VLQWMKNQWPVKNIGPMIP--SMYLD----------KRLAGDKDYGI 250

  Fly   287 ---------------------AIYFSMGSNLKTKDLPPSKVQEILKALGGLKQ---RVLWKFELD 327
                                 .||.|.||....||      .::::...||||   ..||.....
plant   251 NLFNAQVNECLDWLDSKPPGSVIYVSFGSLAVLKD------DQMIEVAAGLKQTGHNFLWVVRET 309

  Fly   328 NLPNKPENVYISD---------WFPQTDILAHPKIMAFVTHGGMLSTTESIYHAKPVIGLPIFSD 383
            .....|.| ||.|         |.||..:|||..|..|:||.|..||.|::.....:||:|.:||
plant   310 ETKKLPSN-YIEDICDKGLIVNWSPQLQVLAHKSIGCFMTHCGWNSTLEALSLGVALIGMPAYSD 373

  Fly   384 QFFN------------MAHAEQNGY----------GIMLDFKTLNAVEFRKAIERITSEPSYTKV 426
            |..|            ...|:|||:          |.:::..:....|.||...|:.........
plant   374 QPTNAKFIEDVWKVGVRVKADQNGFVPKEEIVRCVGEVMEDMSEKGKEIRKNARRLMEFAREALS 438

  Fly   427 VQGISFRYRDQQQTPIENAIYWVEHVTRHQGAAYLKSAAQRLNWW 471
            ..|.|.:..|:....|      |..:..::...||.|      ||
plant   439 DGGNSDKNIDEFVAKI------VRSIEAYRSGRYLSS------WW 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 93/435 (21%)
UGT74D1NP_001325305.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.