DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and UGT87A2

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_180575.1 Gene:UGT87A2 / 817566 AraportID:AT2G30140 Length:455 Species:Arabidopsis thaliana


Alignment Length:465 Identity:100/465 - (21%)
Similarity:170/465 - (36%) Gaps:109/465 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YNYLMVLNSAGRSHFNVGHALAKGLVKAG---HTITVVS------VFPQKKPIPGYTDVSVPNVI 75
            :.:::.:...||.|.|....|.|.||:..   |...||:      :.|..||...:.. ::||:|
plant    11 FRHVVAMPYPGRGHINPMMNLCKRLVRRYPNLHVTFVVTEEWLGFIGPDPKPDRIHFS-TLPNLI 74

  Fly    76 --EVMG-----GDIGALWASIQKTYTQNLIDHYQMGFRITRGLFEDSNFQDFLKSNQSFDAIICE 133
              |::.     |.|.|::..:::.: :.|:|                      ..|....::|..
plant    75 PSELVRAKDFIGFIDAVYTRLEEPF-EKLLD----------------------SLNSPPPSVIFA 116

  Fly   134 TFYNDAHYGLAEHFNAPLIGLATGGG--LTFI--TDMVGSPAPASFVPHIMLPFNDHMSLYERLL 194
            ..|......:....|.|::.|.|...  |:|.  :|::.|...|.|.|.                
plant   117 DTYVIWAVRVGRKRNIPVVSLWTMSATILSFFLHSDLLISHGHALFEPS---------------- 165

  Fly   195 NVAFLGYERVLLDYY--FLPTQEKLYKEFFPG--------NKRCFYKMRRNASLVLIN----QHV 245
                   |..::||.  ..||:.:.....|.|        .|.||.::....||:...    :|.
plant   166 -------EEEVVDYVPGLSPTKLRDLPPIFDGYSDRVFKTAKLCFDELPGARSLLFTTAYELEHK 223

  Fly   246 S-------LSFPRPHSPNMIEVGGMHIDGKWNPLPEKIERFINESEHGAIYFSMGSNLKTKDLPP 303
            :       |..|......:|....:.:... |..|..|:....:.|...:|.|.||.|...:   
plant   224 AIDAFTSKLDIPVYAIGPLIPFEELSVQND-NKEPNYIQWLEEQPEGSVLYISQGSFLSVSE--- 284

  Fly   304 SKVQEILKALGGLKQRVLW-----KFELDNLPNKPENVYISDWFPQTDILAHPKIMAFVTHGGML 363
            ::::||:|.|.....|.||     :.:|.........|.:| |..|..:|.|..:..|.||.|..
plant   285 AQMEEIVKGLRESGVRFLWVARGGELKLKEALEGSLGVVVS-WCDQLRVLCHKAVGGFWTHCGFN 348

  Fly   364 STTESIYHAKPVIGLPIFSDQFFNMAHAEQNGYGIMLDFKTLNAVEFRKAIERITSEPSYTKVVQ 428
            ||.|.||...|::..|:|.||..|...       |:.|::....:|..|..|.:.......:||:
plant   349 STLEGIYSGVPMLAFPLFWDQILNAKM-------IVEDWRVGMRIERTKKNELLIGREEIKEVVK 406

  Fly   429 GISFRYRDQQ 438
                |:.|::
plant   407 ----RFMDRE 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 100/465 (22%)
UGT87A2NP_180575.1 PLN02448 2..455 CDD:215247 100/465 (22%)
YjiC 13..450 CDD:224732 100/463 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.