DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and UGT76D1

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_180216.1 Gene:UGT76D1 / 817189 AraportID:AT2G26480 Length:452 Species:Arabidopsis thaliana


Alignment Length:342 Identity:82/342 - (23%)
Similarity:134/342 - (39%) Gaps:70/342 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 QDFLKSNQSFDAIICETFYNDAHY---GLAEHFNAPLIGLATGGGLTFITDMVGSPAPASFVPHI 179
            ::||.::   |.::....|::..|   .:||..|.|.:..:.....|.|:..|.....::.    
plant    91 KEFLTNH---DDVVDFIIYDEFVYFPRRVAEDMNLPKMVFSPSSAATSISRCVLMENQSNG---- 148

  Fly   180 MLPFNDHMSLYE---------RLLNVAFLGY---ERVLLDYYFLPTQEKLYKEFFPGNKRCFYKM 232
            :||..|..|..|         |..::.|..|   ||:::          ||:..  .|:.....:
plant   149 LLPPQDARSQLEETVPEFHPFRFKDLPFTAYGSMERLMI----------LYENV--SNRASSSGI 201

  Fly   233 RRNASLVLINQHVSLSFPRPHSPNMIEVGGMHIDGKWNPLPEKIERFIN-------ESEHGAIYF 290
            ..|:|..|.|..::.:..:...| :..||.:|:.......|...|...|       :.....||.
plant   202 IHNSSDCLENSFITTAQEKWGVP-VYPVGPLHMTNSAMSCPSLFEEERNCLEWLEKQETSSVIYI 265

  Fly   291 SMGSNLKTKDLPPSKVQEILKALGGLK--QRVLW---------KFELDNLPNKPENV------YI 338
            ||||...|:|     ::.:..|:|.::  |..||         :..||.||.:....      ::
plant   266 SMGSLAMTQD-----IEAVEMAMGFVQSNQPFLWVIRPGSINGQESLDFLPEQFNQTVTDGRGFV 325

  Fly   339 SDWFPQTDILAHPKIMAFVTHGGMLSTTESIYHAKPVIGLPIFSDQFFN---MAHAEQNGYGIML 400
            ..|.||.::|.|..:..|..|||..|..|||....|:|..|...||..|   |:|..|..|.|..
plant   326 VKWAPQKEVLRHRAVGGFWNHGGWNSCLESISSGVPMICRPYSGDQRVNTRLMSHVWQTAYEIEG 390

  Fly   401 DFKTLNAVEFRKAIERI 417
            :.:. .|||.  |:.|:
plant   391 ELER-GAVEM--AVRRL 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 82/342 (24%)
UGT76D1NP_180216.1 Glycosyltransferase_GTB-type 6..445 CDD:415824 82/342 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.