DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt302K1 and UGT2B4

DIOPT Version :9

Sequence 1:NP_001287281.1 Gene:Ugt302K1 / 53502 FlyBaseID:FBgn0040251 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_066962.2 Gene:UGT2B4 / 7363 HGNCID:12553 Length:528 Species:Homo sapiens


Alignment Length:543 Identity:156/543 - (28%)
Similarity:257/543 - (47%) Gaps:101/543 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILGLLCSLGYSSGYNYLMVLNSAGR--------SHFNVGHALAKGLVKAGHTITVVS------- 55
            |::.|.|.  :|||        |.|:        ||:.....:...||:.||.:||::       
Human    10 LLIQLSCY--FSSG--------SCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSASISF 64

  Fly    56 -----------VFPQKKPIPGYTDVSVPNVIEVMGGDIGALWASIQKT-----YTQNLIDHYQMG 104
                       |:|.......:.|: :..:::        .||.:.|.     ::|  :......
Human    65 DPNSPSTLKFEVYPVSLTKTEFEDI-IKQLVK--------RWAELPKDTFWSYFSQ--VQEIMWT 118

  Fly   105 FR-ITRGLFED--SNFQDFLKSNQS-FDAIICETFYNDAHYG--LAEHFNAPLI-------GLAT 156
            |. |.|...:|  ||.:...|..:| ||.::.:..:   .:|  |||....|.:       |.|.
Human   119 FNDILRKFCKDIVSNKKLMKKLQESRFDVVLADAVF---PFGELLAELLKIPFVYSLRFSPGYAI 180

  Fly   157 ---GGGLTFITDMVGSPAPASFVPHIMLPFNDHMSLYERLLNVAFLGYERVLLDYYFLPTQEKLY 218
               .|||.|         |.|:||.:|...:|.|:..||:.|:.::.|    .:::|.....|.:
Human   181 EKHSGGLLF---------PPSYVPVVMSELSDQMTFIERVKNMIYVLY----FEFWFQIFDMKKW 232

  Fly   219 KEFFP---GNKRCFYKMRRNASLVLINQHVSLSFPRPHSPNMIEVGGMHIDGKWNPLPEKIERFI 280
            .:|:.   |......:....|.:.||..:....||.|..||:..|||:|.... .|||:::|.|:
Human   233 DQFYSEVLGRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPA-KPLPKEMEEFV 296

  Fly   281 NES-EHGAIYFSMGSNLKTKDLPPSKVQEILKALGGLKQRVLWKFELDNLPNKPE----NVYISD 340
            ..| |:|.:.||:||  ...:....:...|..||..:.|:|||:|:    .|||:    |..:..
Human   297 QSSGENGVVVFSLGS--MVSNTSEERANVIASALAKIPQKVLWRFD----GNKPDTLGLNTRLYK 355

  Fly   341 WFPQTDILAHPKIMAFVTHGGMLSTTESIYHAKPVIGLPIFSDQFFNMAHAEQNGYGIMLDFKTL 405
            |.||.|:|.|||..||:||||.....|:|||..|::|:|:|:||..|:||.:..|..:.|||.|:
Human   356 WIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTM 420

  Fly   406 NAVEFRKAIERITSEPSYTKVVQGISFRYRDQQQTPIENAIYWVEHVTRHQGAAYLKSAAQRLNW 470
            ::.:...|::.:.::|.|.:....:|..:.||...|::.|::|:|.|.||:||.:|:.||..|.|
Human   421 SSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTW 485

  Fly   471 WQYHNVDV--LLIIFVVMVLLLI 491
            :|||::||  .|:..|..|:.:|
Human   486 FQYHSLDVTGFLLACVATVIFII 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt302K1NP_001287281.1 egt 1..480 CDD:223071 152/530 (29%)
UGT2B4NP_066962.2 egt 8..512 CDD:223071 156/543 (29%)
UDPGT 24..524 CDD:278624 149/519 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150452
Domainoid 1 1.000 260 1.000 Domainoid score I1978
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 1 1.000 - - mtm8543
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.690

Return to query results.
Submit another query.