DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and AT1G51210

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_175532.1 Gene:AT1G51210 / 841544 AraportID:AT1G51210 Length:433 Species:Arabidopsis thaliana


Alignment Length:336 Identity:71/336 - (21%)
Similarity:108/336 - (32%) Gaps:108/336 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 NINNLVGFSTSTLTEPIMPFRAKYVKNVWDRIYNWLYTTEEWLLINLVFLPKQRLIHDHFFGHLE 232
            |:.:|.|:....:...:...|        :.|.|||.:...         |...||.|.|.|..:
plant    91 NVKDLGGYGNPLIMASLRQLR--------EPIVNWLSSHPN---------PPVALISDFFLGWTK 138

  Fly   233 K------SFHEIRQDFALMLLNQHF-----SLFRAR-----PNVPGMVEVAGLHIPKEDPQLP-- 279
            .      :|.......|.:|   ||     .||.:.     .::|........|:|...||.|  
plant   139 DLGIPRFAFFSSGAFLASIL---HFVSDKPHLFESTEPVCLSDLPRSPVFKTEHLPSLIPQSPLS 200

  Fly   280 SDLQVFIDE----AEHGVI-----------------------------LFSLGL-EQDS------ 304
            .||:...|.    :.:|.|                             |.|:|| ::||      
plant   201 QDLESVKDSTMNFSSYGCIFNTCECLEEDYMEYVKQKVSENRVFGVGPLSSVGLSKEDSVSNVDA 265

  Fly   305 -----------------------KDLPRKTQEILVETFKSVPQRVIWKF------DGESTMSLGT 340
                                   |.|.::..:.|....:....|.:|..      ||......|.
plant   266 KALLSWLDGCPDDSVLYICFGSQKVLTKEQCDDLALGLEKSMTRFVWVVKKDPIPDGFEDRVAGR 330

  Fly   341 DIYHSKLLPQQAILAHPNVKLFISHCGMMSVIEAAYYAKPVLGLPSFFDQFRNLEIMKEE-GVAL 404
            .:......||.|:|:|..|..|:.|||..||:||......:|..|...|||.:..::.|. |||:
plant   331 GMIVRGWAPQVAMLSHVAVGGFLIHCGWNSVLEAMASGTMILAWPMEADQFVDARLVVEHMGVAV 395

  Fly   405 ELNINSLTVKE 415
            .:.....||.:
plant   396 SVCEGGKTVPD 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 71/336 (21%)
YjiC 42..445 CDD:224732 71/336 (21%)
AT1G51210NP_175532.1 Glycosyltransferase_GTB-type 18..432 CDD:385653 71/336 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.