DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and UGT85A2

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_173653.1 Gene:UGT85A2 / 838843 AraportID:AT1G22360 Length:481 Species:Arabidopsis thaliana


Alignment Length:89 Identity:24/89 - (26%)
Similarity:49/89 - (55%) Gaps:5/89 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 PQQAILAHPNVKLFISHCGMMSVIEAAYYAKPVLGLPSFFDQFRNLEIMKEE-GVALELNINSLT 412
            ||:.:|:||.:..|::|||..|.:|:.....|::..|.|.:|..|.:..::| .|.:|:. ..:.
plant   361 PQEKVLSHPAIGGFLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSRDEWEVGIEIG-GDVK 424

  Fly   413 VKELKDAIHSMINEPE---YRESA 433
            .:|::..:..:::|.:   .||.|
plant   425 REEVEAVVRELMDEEKGKNMREKA 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 24/89 (27%)
YjiC 42..445 CDD:224732 24/89 (27%)
UGT85A2NP_173653.1 Glycosyltransferase_GTB-type 8..475 CDD:385653 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.