DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and UGT71C3

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_172206.1 Gene:UGT71C3 / 837237 AraportID:AT1G07260 Length:476 Species:Arabidopsis thaliana


Alignment Length:319 Identity:69/319 - (21%)
Similarity:127/319 - (39%) Gaps:72/319 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 ICTCVADWNINN----LVGFSTSTLTEPIMPFRAKYVKNVWDRIYNWLYTTEEW-----LLINLV 215
            |.|...|.:..|    :.|:..|..|:.:.|  ..:|:..::.   |:...|::     :|:|.|
plant   166 ITTSELDLSSGNVEHPIPGYVCSVPTKVLPP--GLFVRESYEA---WVEIAEKFPGAKGILVNSV 225

  Fly   216 FLPKQRLIHDHFFGHLEKSFHEIRQDFALMLLNQHFSLFRARPNVPGMVEVAGLHIPKEDPQLPS 280
            ...:|...  .:|..|::::..:.....::.|..     |..||:..                 |
plant   226 TCLEQNAF--DYFARLDENYPPVYPVGPVLSLKD-----RPSPNLDA-----------------S 266

  Fly   281 D----LQVFIDEAEHGVILFSLGLEQDSKDLPRKTQ-EILVETFKSVPQRVIWKFDGESTMSLG- 339
            |    ::...|:.|..::....|    |..:..|.| |.:.|..:....|.:|......|.... 
plant   267 DRDRIMRWLEDQPESSIVYICFG----SLGIIGKLQIEEIAEALELTGHRFLWSIRTNPTEKASP 327

  Fly   340 --------TDIYHSKLL-----PQQAILAHPNVKLFISHCGMMSVIEAAYYAKPVLGLPSFFDQF 391
                    .|...||.|     ||..:|||..:..|:||||..||:|:.::..|:...|.:.:|.
plant   328 YDLLPEGFLDRTASKGLVCDWAPQVEVLAHKALGGFVSHCGWNSVLESLWFGVPIATWPMYAEQQ 392

  Fly   392 RN-LEIMKEEGVALELNINSLT-------VKELKDAIHSMI---NEPEYRESALAISQR 439
            .| ..::||.|:|:||.::.::       .:|:..||.|::   :.|..|...:|.:.|
plant   393 LNAFSMVKELGLAVELRLDYVSAYGEIVKAEEIAGAIRSLMDGEDTPRKRVKEMAEAAR 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 69/319 (22%)
YjiC 42..445 CDD:224732 69/319 (22%)
UGT71C3NP_172206.1 PLN02167 2..476 CDD:215112 69/319 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.