DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and UGT75B1

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001320882.1 Gene:UGT75B1 / 837058 AraportID:AT1G05560 Length:519 Species:Arabidopsis thaliana


Alignment Length:333 Identity:72/333 - (21%)
Similarity:123/333 - (36%) Gaps:114/333 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 VWDRIYNW---------LYTTEEWLLINLVFLPKQRLIHDHFFGH-----------LE------- 232
            ::..:.||         |.:...|:...|||    .:.:.||.|:           ||       
plant   161 IYTILLNWAPKVARRFQLPSALLWIQPALVF----NIYYTHFMGNKSVFELPNLSSLEIRDLPSF 221

  Fly   233 -----------KSFHE-----IRQDFALMLLNQHFSL----FRARPNVPGMVEVAGLHIPKEDPQ 277
                       .:|.|     |::....:|:|...||    ..|.||: .||.|.        |.
plant   222 LTPSNTNKGAYDAFQEMMEFLIKETKPKILINTFDSLEPEALTAFPNI-DMVAVG--------PL 277

  Fly   278 LPSDL----------------QVFID-EAEHGVILFSLGLEQDSKDLPRKTQEILVETFKSVPQR 325
            ||:::                .:::| :.|..||..|.|   ...:|.:|..|.|........:.
plant   278 LPTEIFSGSTNKSVKDQSSSYTLWLDSKTESSVIYVSFG---TMVELSKKQIEELARALIEGKRP 339

  Fly   326 VIW----------KFDGESTMSLGTDI-----YHSKL---------LPQQAILAHPNVKLFISHC 366
            .:|          |.:||..    |:|     :..:|         ..|..:|:|..|..|::||
plant   340 FLWVITDKSNRETKTEGEEE----TEIEKIAGFRHELEEVGMIVSWCSQIEVLSHRAVGCFVTHC 400

  Fly   367 GMMSVIEAAYYAKPVLGLPSFFDQFRNLEIMKEE---GVALELNINSLTVK-ELKDAIHSMINEP 427
            |..|.:|:.....||:..|.:.||..|.::::|.   ||.:..|.:.|..: |::..:.:::.|.
plant   401 GWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWKTGVRVRENKDGLVERGEIRRCLEAVMEEK 465

  Fly   428 --EYRESA 433
              |.||:|
plant   466 SVELRENA 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 72/333 (22%)
YjiC 42..445 CDD:224732 72/333 (22%)
UGT75B1NP_001320882.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.