DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:170 Identity:40/170 - (23%)
Similarity:65/170 - (38%) Gaps:55/170 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 NVPGMVEVAGLHIPKEDPQLP------------SDLQVFIDEAE-----------HGVILFSLG- 299
            |....:|::.|...:::.::|            :.....:||.|           ..||..||| 
plant   187 NTVSCLEISSLEWLQQELKIPIYPIGPLYMVSSAPPTSLLDENESCIDWLNKQKPSSVIYISLGS 251

  Fly   300 ---LEQDSKDLPRKTQEIL--VETFKSVPQRVIWKFDGESTMSLGTDIYHSKL-----LP----- 349
               ||         |:|:|  .....|..|..:|.....|.  ||:::.:.:|     :|     
plant   252 FTLLE---------TKEVLEMASGLVSSNQYFLWAIRPGSI--LGSELSNEELFSMMEIPDRGYI 305

  Fly   350 -----QQAILAHPNVKLFISHCGMMSVIEAAYYAKPVLGL 384
                 |:.:|||..|..|.||||..|.:|:.....|::||
plant   306 VKWATQKQVLAHAAVGAFWSHCGWNSTLESIGEGIPIVGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 40/170 (24%)
YjiC 42..445 CDD:224732 40/170 (24%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 38/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.