DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and UGT72E3

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_198003.1 Gene:UGT72E3 / 832700 AraportID:AT5G26310 Length:481 Species:Arabidopsis thaliana


Alignment Length:155 Identity:34/155 - (21%)
Similarity:64/155 - (41%) Gaps:41/155 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 QRVIW----KFDGESTMSLGTDIYHSK-----------------------------LLPQQAILA 355
            ||.||    ..||.|.    :|.:.:|                             ..||..|||
plant   293 QRFIWVVRPPVDGSSC----SDYFSAKGGVTKDNTPEYLPEGFVTRTCDRGFMIPSWAPQAEILA 353

  Fly   356 HPNVKLFISHCGMMSVIEAAYYAKPVLGLPSFFDQFRNLEIMKEE-GVALELN--INSLTVKELK 417
            |..|..|::|||..|.:|:.....|::..|.|.:|..|..::.:| |:::.::  ..:::..:::
plant   354 HQAVGGFLTHCGWSSTLESVLCGVPMIAWPLFAEQNMNAALLSDELGISVRVDDPKEAISRSKIE 418

  Fly   418 DAIHSMINEPEYRESALAISQRFRD 442
            ..:..::.|.|..|....: ::.||
plant   419 AMVRKVMAEDEGEEMRRKV-KKLRD 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 34/155 (22%)
YjiC 42..445 CDD:224732 34/155 (22%)
UGT72E3NP_198003.1 PLN02992 1..481 CDD:178572 34/155 (22%)
YjiC 5..442 CDD:224732 32/153 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.