DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and UGT78D2

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:339 Identity:68/339 - (20%)
Similarity:117/339 - (34%) Gaps:106/339 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ESVGIASANNKWEEISSMSSLMANATLNVLNNVEVRALMKSRI--TFDAVVLEAGYSDVLYGMAA 151
            |::|:.....:.||           |:.|::.:|     |.|:  |.:.||.  |..|.::....
plant   162 ETIGVKEVGERMEE-----------TIGVISGME-----KIRVKDTPEGVVF--GNLDSVFSKML 208

  Fly   152 HFSAQLIGICTCVADWNINNLVGFSTSTLTEPIMPFRAKYVKNVWDRIYNWLYTTEEWLLINLVF 216
            |.....:...|.|.   ||:..... .|||..:   |:::                         
plant   209 HQMGLALPRATAVF---INSFEDLD-PTLTNNL---RSRF------------------------- 241

  Fly   217 LPKQRLIHDHFFGHLEKSFHEIRQDFALMLLNQHFSLFRARPNVPGMVEVAGLHIPKEDPQLPSD 281
               :|.::....|.|..:..::.||       .|..|........|.|...........|  |.:
plant   242 ---KRYLNIGPLGLLSSTLQQLVQD-------PHGCLAWMEKRSSGSVAYISFGTVMTPP--PGE 294

  Fly   282 LQVFIDEAEHGVILFSLGLEQDS-KDLPR----KTQEILVETFKSVPQRVI--WKFDGESTMSLG 339
            |....:..|...:.|...|::.| ..||:    :|:|          |.::  |           
plant   295 LAAIAEGLESSKVPFVWSLKEKSLVQLPKGFLDRTRE----------QGIVVPW----------- 338

  Fly   340 TDIYHSKLLPQQAILAHPNVKLFISHCGMMSVIEAAYYAKPVLGLPSFFDQFRN---LEIMKEEG 401
                    .||..:|.|....:|::|||..||:|:.....|::..|.|.||..|   :|::.|.|
plant   339 --------APQVELLKHEATGVFVTHCGWNSVLESVSGGVPMICRPFFGDQRLNGRAVEVVWEIG 395

  Fly   402 VALELNINSLTVKE 415
            :.:   ||.:..|:
plant   396 MTI---INGVFTKD 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 68/339 (20%)
YjiC 42..445 CDD:224732 68/339 (20%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 68/339 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.