powered by:
Protein Alignment Ugt304A1 and UGT78D3
DIOPT Version :9
Sequence 1: | NP_652619.1 |
Gene: | Ugt304A1 / 53501 |
FlyBaseID: | FBgn0040250 |
Length: | 529 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_197205.1 |
Gene: | UGT78D3 / 831566 |
AraportID: | AT5G17030 |
Length: | 459 |
Species: | Arabidopsis thaliana |
Alignment Length: | 63 |
Identity: | 20/63 - (31%) |
Similarity: | 33/63 - (52%) |
Gaps: | 3/63 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 349 PQQAILAHPNVKLFISHCGMMSVIEAAYYAKPVLGLPSFFD---QFRNLEIMKEEGVALELNI 408
||..:|.|..:.:|:||.|..||:|:.....|::..|.|.| ..|::|.:.|.||.:...:
plant 339 PQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHAINARSVEAVWEIGVTISSGV 401
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
76 |
1.000 |
Domainoid score |
I3136 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
89 |
1.000 |
Inparanoid score |
I2281 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X13 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.050 |
|
Return to query results.
Submit another query.