DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and AT4G36770

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_195395.4 Gene:AT4G36770 / 829830 AraportID:AT4G36770 Length:457 Species:Arabidopsis thaliana


Alignment Length:320 Identity:66/320 - (20%)
Similarity:106/320 - (33%) Gaps:113/320 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 LYTTEEWLLINLVF---LPKQRL--------------------------------------IHDH 226
            |.||..|.|...|:   |.||.|                                      |.|.
plant   133 LVTTSAWFLAFTVYMASLDKQELYKQLSSIGALLIPGCSPVKFERAQDPRKYIRELAESQRIGDE 197

  Fly   227 FF---GHLEKSFHEIRQDFALMLLNQHFSLFRARPNVPGMVEVAGLHIPKEDPQLPSDLQVFIDE 288
            ..   |....::|.:.|......|:.. :|.|....||  |...|..:...:|.|          
plant   198 VITADGVFVNTWHSLEQVTIGSFLDPE-NLGRVMRGVP--VYPVGPLVRPAEPGL---------- 249

  Fly   289 AEHGVILFSLGLEQDSKDLPRKTQEILVE-------TFKSVPQ----------RVIW-------- 328
             :|||:        |..||..|...:.|.       ||:...:          |.:|        
plant   250 -KHGVL--------DWLDLQPKESVVYVSFGSGGALTFEQTNELAYGLELTGHRFVWVVRPPAED 305

  Fly   329 -----KFDGESTMSLGTDIYHSKLL--------------PQQAILAHPNVKLFISHCGMMSVIEA 374
                 .||.....:...|...:..|              ||:.||||.:...|::|||..||:|:
plant   306 DPSASMFDKTKNETEPLDFLPNGFLDRTKDIGLVVRTWAPQEEILAHKSTGGFVTHCGWNSVLES 370

  Fly   375 AYYAKPVLGLPSFFDQFRNLEIMKEE-GVALELNINSLTVKE--LKDAIHSMINEPEYRE 431
            .....|::..|.:.:|..|..::..| .:||::|:....||:  :.:.:..:::|.|.:|
plant   371 IVNGVPMVAWPLYSEQKMNARMVSGELKIALQINVADGIVKKEVIAEMVKRVMDEEEGKE 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 66/320 (21%)
YjiC 42..445 CDD:224732 66/320 (21%)
AT4G36770NP_195395.4 Glycosyltransferase_GTB_type 4..448 CDD:299143 66/320 (21%)
YjiC 6..451 CDD:224732 66/320 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.