DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and UGT71B5

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001328018.1 Gene:UGT71B5 / 827194 AraportID:AT4G15280 Length:510 Species:Arabidopsis thaliana


Alignment Length:367 Identity:74/367 - (20%)
Similarity:146/367 - (39%) Gaps:97/367 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LMANATLNVLNNVEVRALM--KSRITFDAVVLEAGYSDVLYGMAAHFSAQLIGICTCVADWNINN 171
            :..::.::|.|...|...|  .|..||...:|   :...:|....:..::|           .|:
plant   151 MFCSSMIDVANEFGVPCYMVYTSNATFLGTML---HVQQMYDQKKYDVSEL-----------ENS 201

  Fly   172 LVGFSTSTLTEPIMPFRAKYVKNVWDRIYNWLYTTEEWLLINLVFLPKQRLIHDHFFGHLEKSFH 236
            :......:||.   |:..|.:.::        .|::|||.::|.    |........|.|..:..
plant   202 VTELEFPSLTR---PYPVKCLPHI--------LTSKEWLPLSLA----QARCFRKMKGILVNTVA 251

  Fly   237 EIRQDFALMLLNQHFSLFRARPNVPGMVEVAGLHIPKEDPQLPSDLQVFIDEAEHGVILF----S 297
            |: :..||.:.|.:..   ..|.|..:..|..|....:|.:..|::..::||.....::|    |
plant   252 EL-EPHALKMFNINGD---DLPQVYPVGPVLHLENGNDDDEKQSEILRWLDEQPSKSVVFLCFGS 312

  Fly   298 LG--LEQDSK--------------------------DLPR---KTQEILVETFKSVPQRVIWKFD 331
            ||  .|:.::                          |.||   ..:|:|.|.|.           
plant   313 LGGFTEEQTRETAVALDRSGQRFLWCLRHASPNIKTDRPRDYTNLEEVLPEGFL----------- 366

  Fly   332 GESTMSLGTDIYHSKLLPQQAILAHPNVKLFISHCGMMSVIEAAYYAKPVLGLPSFFDQFRN-LE 395
             |.|:..|..|..:   ||.|:|..|.:..|::|||..|::|:.::..|::..|.:.:|..| .|
plant   367 -ERTLDRGKVIGWA---PQVAVLEKPAIGGFVTHCGWNSILESLWFGVPMVTWPLYAEQKVNAFE 427

  Fly   396 IMKEEGVALEL-----------NINSLTVKELKDAIHSMINE 426
            :::|.|:|:|:           .:.::|.::::.||..::.:
plant   428 MVEELGLAVEIRKYLKGDLFAGEMETVTAEDIERAIRRVMEQ 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 74/367 (20%)
YjiC 42..445 CDD:224732 74/367 (20%)
UGT71B5NP_001328018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.