DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and AT4G15260

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_193261.2 Gene:AT4G15260 / 827192 AraportID:AT4G15260 Length:359 Species:Arabidopsis thaliana


Alignment Length:378 Identity:76/378 - (20%)
Similarity:147/378 - (38%) Gaps:120/378 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LMANATLNVLNNVEVRALM--KSRITFDAVVL--EAGYSDVLYGMAAHFSAQLIGICTCVADWNI 169
            :..::.:::.|...|...|  .|..||..:.|  :..|.|..|.::.             .|.::
plant     1 MFCSSMIDIANEFGVPCYMIYTSNATFLGITLHVQEMYDDKKYDVSD-------------LDESV 52

  Fly   170 NNLVGFSTSTLTEPIMPFRAKYVKNVWDRIYNWLYTTEEWLLINLVFLPKQRLIHDHFFGHLEKS 234
            |.|   ....||.   |:..|.:.::        .::::||               .||....:|
plant    53 NEL---EFPCLTR---PYPVKCLPHI--------LSSKDWL---------------PFFAAQGRS 88

  Fly   235 FHEIR----------QDFALMLLNQHFSLFRARPNVPGMVEVAGLHIPKEDPQLPSDLQV--FID 287
            |.:::          :..||.:.| :..|.:|.|..|      .||:...|......|:|  ::|
plant    89 FRKMKGILVNTVAELEPHALKMFN-NVDLPQAYPVGP------VLHLDNGDDDDEKRLEVLRWLD 146

  Fly   288 EAEHGVILF----SLG--LEQDSKDLPRKTQEILVETFKSVPQRVIWKF---------------- 330
            :.....:||    |:|  .|:       :|:|:.|...:| ..|.:|..                
plant   147 DQPPKSVLFLCFGSMGGFTEE-------QTREVAVALNRS-GHRFLWSLRRASPNIMMERPGDYK 203

  Fly   331 -------DG--ESTMSLGTDIYHSKLLPQQAILAHPNVKLFISHCGMMSVIEAAYYAKPVLGLPS 386
                   ||  |.|:..|..|..:   ||.|:|..|.:..|::|||..|::|:.::..|::..|.
plant   204 NLEEVLPDGFLERTLDRGKVIGWA---PQVAVLEKPAIGGFVTHCGWNSMLESLWFGVPMVTWPL 265

  Fly   387 FFDQFRN-LEIMKEEGVALEL------------NINSLTVKELKDAIHSMINE 426
            :.:|..| .|:::|.|:|:|:            .:..:|.::::.||..::.:
plant   266 YAEQKVNAFEMVEELGLAVEIRKCISGDLLLIGEMEIVTAEDIERAIRCVMEQ 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 76/378 (20%)
YjiC 42..445 CDD:224732 76/378 (20%)
AT4G15260NP_193261.2 Glycosyltransferase_GTB_type <1..359 CDD:299143 76/378 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.