DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and UGT73C7

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_190884.1 Gene:UGT73C7 / 824482 AraportID:AT3G53160 Length:490 Species:Arabidopsis thaliana


Alignment Length:249 Identity:52/249 - (20%)
Similarity:94/249 - (37%) Gaps:72/249 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 FGHLEKSFHEIRQDFALMLLNQHFSLFRARPNVPGMVEVAG-------LHIPK----EDPQLPSD 281
            :|.:..:|.|:..|:|     :.:...||     |.|...|       |.:.|    :...:..|
plant   216 YGVIVNTFEELEVDYA-----REYRKARA-----GKVWCVGPVSLCNRLGLDKAKRGDKASIGQD 270

  Fly   282 --LQVFIDEAEHGVILF-----------------SLGLEQDSKDLPRKTQEILVETFKSVPQRVI 327
              || ::|..|.|.:|:                 .||||..:|......:|              
plant   271 QCLQ-WLDSQETGSVLYVCLGSLCNLPLAQLKELGLGLEASNKPFIWVIRE-------------- 320

  Fly   328 WKFDGESTMSLGTDIYHSKL----------LPQQAILAHPNVKLFISHCGMMSVIEAAYYAKPVL 382
            |...|:....:....:..::          .||..||:|.::..|::|||..|.:|......|:|
plant   321 WGKYGDLANWMQQSGFEERIKDRGLVIKGWAPQVFILSHASIGGFLTHCGWNSTLEGITAGVPLL 385

  Fly   383 GLPSFFDQFRN----LEIMKEEGVALELNINSLTVKELKDAIHSMINEPEYRES 432
            ..|.|.:||.|    ::|:|   ..|::.:..|.....::.|.:|::....|::
plant   386 TWPLFAEQFLNEKLVVQILK---AGLKIGVEKLMKYGKEEEIGAMVSRECVRKA 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 52/249 (21%)
YjiC 42..445 CDD:224732 52/249 (21%)
UGT73C7NP_190884.1 Glycosyltransferase_GTB_type 7..489 CDD:299143 52/249 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.