DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and AT3G22250

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_188864.1 Gene:AT3G22250 / 821795 AraportID:AT3G22250 Length:461 Species:Arabidopsis thaliana


Alignment Length:99 Identity:23/99 - (23%)
Similarity:50/99 - (50%) Gaps:13/99 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 PQQAILAHPNVKLFISHCGMMSVIEAAYYAKPVLGLPSFFDQFRN----LEIMKEEGVALELNIN 409
            ||..:|.:.:|..:::|||..|.:||...::.:|..|...|||.|    :::.|     :.:.::
plant   350 PQLEVLRNDSVGCYVTHCGWNSTMEAVASSRRLLCYPVAGDQFVNCKYIVDVWK-----IGVRLS 409

  Fly   410 SLTVKELKDAIHSMINEPEYRESALAISQRFRDQ 443
            ....||::|.:..::.:.:..|..    ::.||:
plant   410 GFGEKEVEDGLRKVMEDQDMGERL----RKLRDR 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 23/99 (23%)
YjiC 42..445 CDD:224732 23/99 (23%)
AT3G22250NP_188864.1 PLN02562 1..461 CDD:215305 23/99 (23%)
YjiC 6..445 CDD:224732 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.