DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and UGT71B8

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_188817.1 Gene:UGT71B8 / 821734 AraportID:AT3G21800 Length:480 Species:Arabidopsis thaliana


Alignment Length:326 Identity:74/326 - (22%)
Similarity:131/326 - (40%) Gaps:101/326 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 TEEWLLINLVFLPKQRLIHDHFFGHLEKSFHEIRQDFALMLLNQHFSLFRARPNVPGMVEVAGLH 270
            |:|||   .::|.:.|...: ..|.|..:|.|: :.:||..|:......||.|..| ::.:.. |
plant   193 TKEWL---PMYLNQGRRFRE-MKGILVNTFAEL-EPYALESLHSSGDTPRAYPVGP-LLHLEN-H 250

  Fly   271 IPKEDPQLPSDLQVFIDEAEHGVILF-----------------SLGLEQD--------------- 303
            :.....:..||:..::||.....::|                 ::.||:.               
plant   251 VDGSKDEKGSDILRWLDEQPPKSVVFLCFGSIGGFNEEQAREMAIALERSGHRFLWSLRRASRDI 315

  Fly   304 SKDLP---RKTQEILVETFKSVPQRVIWKFDGESTMSLGTDIYHSKLLPQQAILAHPNVKLFISH 365
            .|:||   :..:|||.|.|          ||  .|...|..|..:   ||.|:||.|.:..|::|
plant   316 DKELPGEFKNLEEILPEGF----------FD--RTKDKGKVIGWA---PQVAVLAKPAIGGFVTH 365

  Fly   366 CGMMSVIEAAYYAKPVLGLPSFFDQFRNLEIMKEE-GVALELN--------INSLTV----KELK 417
            ||..|::|:.::..|:...|.:.:|..|..:|.|| |:|:::.        :.:.||    :|::
plant   366 CGWNSILESLWFGVPIAPWPLYAEQKFNAFVMVEELGLAVKIRKYWRGDQLVGTATVIVTAEEIE 430

  Fly   418 DAIHSMI-NEPEYRESALAISQRFRDQPIHPLDAAIYWTEYIIRYKGADHMKI-----SQSQLKL 476
            ..|..:: .:.:.|.....:|::.                         ||.:     |||.|||
plant   431 RGIRCLMEQDSDVRNRVKEMSKKC-------------------------HMALKDGGSSQSALKL 470

  Fly   477 F 477
            |
plant   471 F 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 74/326 (23%)
YjiC 42..445 CDD:224732 65/287 (23%)
UGT71B8NP_188817.1 PLN02554 2..480 CDD:215304 74/326 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.