DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and HYR1

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_188813.1 Gene:HYR1 / 821730 AraportID:AT3G21760 Length:485 Species:Arabidopsis thaliana


Alignment Length:367 Identity:80/367 - (21%)
Similarity:142/367 - (38%) Gaps:106/367 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LNVLNNVEVRALM--KSRITFDAVVLEAGYSDVLYGMAAHFSAQLIGICTCVADWNINNLVGFST 177
            ::|.|...|.:.|  .|..||..:.:...|   ||.               |.::::::|....|
plant   129 IDVANEFGVPSYMFYTSNATFLGLQVHVEY---LYD---------------VKNYDVSDLKDSDT 175

  Fly   178 STLTEPIM--PFRAKYVKNVWDRIYNWLYTTEEWLLINLVFLPKQRLIHDHFFGHLEKSFHEIRQ 240
            :.|..|.:  |...|...:|        ..|:|||.:  :|...:|.....  |.|..:|.|:..
plant   176 TELEVPCLTRPLPVKCFPSV--------LLTKEWLPV--MFRQTRRFRETK--GILVNTFAELEP 228

  Fly   241 DFALMLLNQHFSLFRA----RPNVPGMVEVAGLHI--PKEDPQLPSDLQVFIDEAEHGVILF--- 296
                    |....|..    .|.|..:..|..|.|  |.......|::..::||.....::|   
plant   229 --------QAMKFFSGVDSPLPTVYTVGPVMNLKINGPNSSDDKQSEILRWLDEQPRKSVVFLCF 285

  Fly   297 -SLGLEQDSKDLPRKTQEILVETFKSVPQRVIWKF-----------------------DG--EST 335
             |:|..::.     :.:||.:...:| ..|.:|..                       :|  |.|
plant   286 GSMGGFREG-----QAKEIAIALERS-GHRFVWSLRRAQPKGSIGPPEEFTNLEEILPEGFLERT 344

  Fly   336 MSLGTDIYHSKLL---PQQAILAHPNVKLFISHCGMMSVIEAAYYAKPVLGLPSFFDQFRN-LEI 396
            ..:|      |::   ||.||||:|.:..|:||||..|.:|:.::..|:...|.:.:|..| .|:
plant   345 AEIG------KIVGWAPQSAILANPAIGGFVSHCGWNSTLESLWFGVPMATWPLYAEQQVNAFEM 403

  Fly   397 MKEEGVALELNINS------------LTVKELKDAIHSMINE 426
            ::|.|:|:|:. ||            :|.:|::..|..::.:
plant   404 VEELGLAVEVR-NSFRGDFMAADDELMTAEEIERGIRCLMEQ 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 80/367 (22%)
YjiC 42..445 CDD:224732 80/367 (22%)
HYR1NP_188813.1 PLN02554 1..485 CDD:215304 80/367 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.