DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and UGT71B1

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_188812.1 Gene:UGT71B1 / 821729 AraportID:AT3G21750 Length:473 Species:Arabidopsis thaliana


Alignment Length:304 Identity:66/304 - (21%)
Similarity:109/304 - (35%) Gaps:103/304 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 FSTSTLTEPIMPFRAKYVKNVWDRIYNWLYTTEEWLLINLVFLPKQRLIHDHFFGHLEKSFHEIR 239
            |...|||:   ||.||.:.:|               ::|..:.|       :..|. .:||...:
plant   165 FDVPTLTQ---PFPAKCLPSV---------------MLNKKWFP-------YVLGR-ARSFRATK 203

  Fly   240 QDFALMLLN-------QHFSLF---RARPNVPGMVEVAGLHIPKEDPQLPSDLQVFIDEAEHGVI 294
            .    :|:|       |..|.|   ....|:|.:..|..:          .||:...||.:...|
plant   204 G----ILVNSVADMEPQALSFFSGGNGNTNIPPVYAVGPI----------MDLESSGDEEKRKEI 254

  Fly   295 LFSLGLEQDSKDL------------PRKTQEILVETFKSVPQRVIWKF-------------DGE- 333
            |..| .||.:|.:            ..:.:||.|...:| ..|.:|..             .|| 
plant   255 LHWL-KEQPTKSVVFLCFGSMGGFSEEQAREIAVALERS-GHRFLWSLRRASPVGNKSNPPPGEF 317

  Fly   334 -------------STMSLGTDIYHSKLLPQQAILAHPNVKLFISHCGMMSVIEAAYYAKPVLGLP 385
                         .|:.:|..|   ...||..:|..|.:..|::|||..|::|:.::..|:...|
plant   318 TNLEEILPKGFLDRTVEIGKII---SWAPQVDVLNSPAIGAFVTHCGWNSILESLWFGVPMAAWP 379

  Fly   386 SFFD-QFRNLEIMKEEGVALELNINSLTVKELKDAIHSMINEPE 428
            .:.: ||....::.|.|:|.|:.      ||.:...  ::.|||
plant   380 IYAEQQFNAFHMVDELGLAAEVK------KEYRRDF--LVEEPE 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 66/304 (22%)
YjiC 42..445 CDD:224732 66/304 (22%)
UGT71B1NP_188812.1 Glycosyltransferase_GTB_type 1..473 CDD:299143 66/304 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.