DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and UGT74F2

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_181910.1 Gene:UGT74F2 / 818986 AraportID:AT2G43820 Length:449 Species:Arabidopsis thaliana


Alignment Length:109 Identity:27/109 - (24%)
Similarity:48/109 - (44%) Gaps:28/109 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 KLLPQQAILAHPNVKLFISHCGMMSVIEAAYYAKPVLGLPSFFDQFRNLEIM------------- 397
            |..||..:|::..:..|::|||..|.:||..:..|::.:|.:.||..|.:.:             
plant   323 KWSPQLQVLSNKAIGCFLTHCGWNSTMEALTFGVPMVAMPQWTDQPMNAKYIQDVWKAGVRVKTE 387

  Fly   398 KEEGVA----LELNINSL-----------TVKELKDAIHSMINE 426
            ||.|:|    :|.:|..:           .||:.:|.....:||
plant   388 KESGIAKREEIEFSIKEVMEGERSKEMKKNVKKWRDLAVKSLNE 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 27/109 (25%)
YjiC 42..445 CDD:224732 27/109 (25%)
UGT74F2NP_181910.1 PLN02173 1..449 CDD:177830 27/109 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.