DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and UGT74D1

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001325305.1 Gene:UGT74D1 / 817732 AraportID:AT2G31750 Length:490 Species:Arabidopsis thaliana


Alignment Length:243 Identity:55/243 - (22%)
Similarity:94/243 - (38%) Gaps:53/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 WLLINLVFLPKQRLIHDHFFG------HLEKSFHEIRQDFALMLLNQHFSLFRARPNVPGMVEVA 267
            :|..|.:..|...||...|..      .|..||.|:..:....:.|| :.:....|.:|.|.   
plant   177 FLYDNNLCRPLFELISSQFVNVDDIDFFLVNSFDELEVEVLQWMKNQ-WPVKNIGPMIPSMY--- 237

  Fly   268 GLHIPKEDPQLPSDLQVFIDEAEHGVILFSLGLEQ-----DSK-----------DLPRKTQEILV 316
                  .|.:|..|       .::|:.||:..:.:     |||           .|.....:.::
plant   238 ------LDKRLAGD-------KDYGINLFNAQVNECLDWLDSKPPGSVIYVSFGSLAVLKDDQMI 289

  Fly   317 ET---FKSVPQRVIWKFDGESTMSLGT----DIYHSKLL----PQQAILAHPNVKLFISHCGMMS 370
            |.   .|......:|......|..|.:    ||....|:    ||..:|||.::..|::|||..|
plant   290 EVAAGLKQTGHNFLWVVRETETKKLPSNYIEDICDKGLIVNWSPQLQVLAHKSIGCFMTHCGWNS 354

  Fly   371 VIEAAYYAKPVLGLPSFFDQFRNLEIMKE---EGVALELNINSLTVKE 415
            .:||......::|:|::.||..|.:.:::   .||.::.:.|....||
plant   355 TLEALSLGVALIGMPAYSDQPTNAKFIEDVWKVGVRVKADQNGFVPKE 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 55/243 (23%)
YjiC 42..445 CDD:224732 55/243 (23%)
UGT74D1NP_001325305.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.