DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and UGT2A2

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001099147.2 Gene:UGT2A2 / 574537 HGNCID:28183 Length:536 Species:Homo sapiens


Alignment Length:261 Identity:92/261 - (35%)
Similarity:157/261 - (60%) Gaps:7/261 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LMLLNQHFSLFRARPNVPGMVEVAGLHIPKEDPQLPSDLQVFIDEA-EHGVILFSLGLEQDSKDL 307
            :.|:..::.....||.:|....|.|||.....| ||.:::.||..: ::||::||||  ...|:|
Human   262 IWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKP-LPKEMEEFIQSSGKNGVVVFSLG--SMVKNL 323

  Fly   308 PRKTQEILVETFKSVPQRVIWKFDGESTMSLGTDIYHSKLLPQQAILAHPNVKLFISHCGMMSVI 372
            ..:...::......:||:|:|::.|:...:||.:......:||..:|.||..|.||:|.|...:.
Human   324 TEEKANLIASALAQIPQKVLWRYKGKKPATLGNNTQLFDWIPQNDLLGHPKTKAFITHGGTNGIY 388

  Fly   373 EAAYYAKPVLGLPSFFDQFRNLEIMKEEGVALELNINSLTVKELKDAIHSMINEPEYRESALAIS 437
            ||.|:..|::|:|.|.||..|:..||.:|.|:|:|:|::|..:|..|:.::||||.|:|:|:.:|
Human   389 EAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTSVDLLSALRTVINEPSYKENAMRLS 453

  Fly   438 QRFRDQPIHPLDAAIYWTEYIIRYKGADHMKISQSQLKLFDYYSLDNFIMVGSRLSLVVALVFLV 502
            :...|||:.|||.|::|.|:::|:|||.|::::...|..|.|:|||   ::|..|..|...:|||
Human   454 RIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLD---VIGFLLVCVTTAIFLV 515

  Fly   503 L 503
            :
Human   516 I 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 82/236 (35%)
YjiC 42..445 CDD:224732 68/201 (34%)
UGT2A2NP_001099147.2 UDPGT 30..524 CDD:278624 92/261 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150181
Domainoid 1 1.000 260 1.000 Domainoid score I1978
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.690

Return to query results.
Submit another query.