powered by:
Protein Alignment Ugt304A1 and T19H12.12
DIOPT Version :9
Sequence 1: | NP_652619.1 |
Gene: | Ugt304A1 / 53501 |
FlyBaseID: | FBgn0040250 |
Length: | 529 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001024147.2 |
Gene: | T19H12.12 / 3565072 |
WormBaseID: | WBGene00044282 |
Length: | 153 |
Species: | Caenorhabditis elegans |
Alignment Length: | 60 |
Identity: | 13/60 - (21%) |
Similarity: | 25/60 - (41%) |
Gaps: | 5/60 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 SSRILVIAPFESHSQCMLVTPYIQALKDRGHQLTVIHAYKHCMHKIEDVTFIRIWYNNNV 83
||:||:..|....|....::.....:.|.||.:|:...|...:..::.:. .|.|:
Worm 18 SSKILIFNPIYGFSHVKFISKVADIIADHGHHVTLFQPYHIALKNLDGLV-----KNKNI 72
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Ugt304A1 | NP_652619.1 |
egt |
8..480 |
CDD:223071 |
13/60 (22%) |
YjiC |
42..445 |
CDD:224732 |
7/42 (17%) |
T19H12.12 | NP_001024147.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000004 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100052 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.