DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt304A1 and Y43D4A.2

DIOPT Version :9

Sequence 1:NP_652619.1 Gene:Ugt304A1 / 53501 FlyBaseID:FBgn0040250 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_502984.3 Gene:Y43D4A.2 / 189851 WormBaseID:WBGene00012788 Length:151 Species:Caenorhabditis elegans


Alignment Length:184 Identity:33/184 - (17%)
Similarity:68/184 - (36%) Gaps:66/184 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SMSSLMANATLNVLNNVEVRALMKSRITFDAVVLEA--GYSDVLY---GMAAHFSAQLIGICTCV 164
            :||::.|:....||.:.|:...:::. .||..:.|.  ..::.|:   .:.||     :.:.:|.
 Worm    14 AMSAIFASQCRKVLEDKELIERLRAE-NFDLAITEPFDTCANALFEAIKIRAH-----VAVLSCS 72

  Fly   165 ADWNINNLVGFSTSTLTEPIMPFRAKYV----------KNVWDRIYNWLYTTEEWLLINLVFLPK 219
            ...:::..:|       :||.|   .|:          ..:|.|..|.|:.              
 Worm    73 RLDHVSKAIG-------QPIAP---SYLPGTQSTHGERMTIWQRFMNILHF-------------- 113

  Fly   220 QRLIHDHFFGHLEKSFHEIRQDFALMLLNQHFSLFRARPNVPGM--VEVAGLHI 271
              |:.|..|.::..      :||.:           |:..:||:  ..|:||.:
 Worm   114 --LMGDFLFSYIGD------EDFKV-----------AKEIIPGVRSWRVSGLEL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt304A1NP_652619.1 egt 8..480 CDD:223071 33/184 (18%)
YjiC 42..445 CDD:224732 33/184 (18%)
Y43D4A.2NP_502984.3 UDPGT 14..>120 CDD:278624 24/137 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.