DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLN and Pln

DIOPT Version :10

Sequence 1:NP_002658.1 Gene:PLN / 5350 HGNCID:9080 Length:52 Species:Homo sapiens
Sequence 2:NP_075618.1 Gene:Pln / 18821 MGIID:97622 Length:52 Species:Mus musculus


Alignment Length:52 Identity:51/52 - (98%)
Similarity:51/52 - (98%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL 52
            ||||||||||||||||||||||||||.|||||||||||||||||||||||||
Mouse     1 MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLNNP_002658.1 P_lamban 1..52 CDD:273541 49/50 (98%)
Involved in HAX1 binding 16..22 5/5 (100%)
PlnNP_075618.1 P_lamban 1..52 CDD:273541 49/50 (98%)

Return to query results.
Submit another query.