DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP1029 and CG10602

DIOPT Version :9

Sequence 1:NP_001263065.1 Gene:SP1029 / 53473 FlyBaseID:FBgn0263236 Length:932 Species:Drosophila melanogaster
Sequence 2:NP_609916.5 Gene:CG10602 / 35146 FlyBaseID:FBgn0032721 Length:684 Species:Drosophila melanogaster


Alignment Length:573 Identity:142/573 - (24%)
Similarity:225/573 - (39%) Gaps:160/573 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SVKILIEALENTKNVTLHSKNLTIDESQITLRQ----IGGEGKKENCVSSTAVNPSHDFYILNTC 122
            :.||....|...|.:|.:...:.:|...|.:..    .||        |...:|    |:|.:..
  Fly   104 ATKIQGSVLHRFKVLTANLDKILLDVRDINVTNATLLAGG--------SELPIN----FFISDAV 156

  Fly   123 QELLAGNTYELYMPFA---ADLNRQLEGYYRSSYKDPVANLTKWISVT------------QFEPA 172
            .::  |....|.:|..   ..||.::: |..||    .|:..:|::.|            |.:..
  Fly   157 DDI--GQKLTLELPSGTAKGSLNVRID-YETSS----SASGLQWLNPTQTLGKEHPYMFSQCQAI 214

  Fly   173 SARLAFPCFDEPDFKAPFVVTLGYHKKYTAISNMPEKETKPHETLADYIWCEFQESVPMSTYLVA 237
            .||...||.|.|..|..:..|:.:..:.||:.:....:.:|.:||       |::.||:..||||
  Fly   215 HARSVIPCQDTPAVKFTYDATVEHPSELTALMSALIDKKEPGKTL-------FKQEVPIPAYLVA 272

  Fly   238 YSVNDFSHKPSTLPNSALFRTWARPNAIDQCDYAAQF--------------GPKVLQYYEQFFGI 288
            .::.....:|.. .||::   ||....:|.|  |.:|              ||.|.:.|:..   
  Fly   273 IAIGKLVSRPLG-ENSSV---WAEEAIVDAC--AEEFSETATMLKTATELCGPYVWKQYDLL--- 328

  Fly   289 KFPLPKIDQIAVPDFSAGAMENWGLVTYREIALLYSAAHSSLADKQRVASVVAHELAHQWFGNLV 353
                     :..|.|..|.||| ..:|:....||  |...||||      |||||:||.|.||||
  Fly   329 ---------VMPPSFPFGGMEN-PCLTFVTPTLL--AGDKSLAD------VVAHEIAHSWTGNLV 375

  Fly   354 TMKWWTDLWLNEGFATYVASLGVENINPEWRSMEQESLSNLLTIFR--RDALESSHPISRPIQMV 416
            |.|.:...||||||..:|.|..|..:... :.::.:.||||..:..  |..|..:..:::   :|
  Fly   376 TNKNFEHFWLNEGFTVFVESKIVGRMQGA-KELDFKMLSNLTDLQECIRTQLNKTPELTK---LV 436

  Fly   417 SEIS-----ESFDQISYQKGSTVLRMMH-LFLGEESFRSGLQAYLQKFSYKNAEQD--------- 466
            .::|     ::|..:.|.||||.||.:. ||.|...|...|:.||:|::||:.|..         
  Fly   437 VDLSNCGPDDAFSSVPYIKGSTFLRYLEDLFGGPTVFEPFLRDYLKKYAYKSIETKDFQSALYDY 501

  Fly   467 ---------------NLW--------------ESLTQAAHKYRSLPKSYDIKSIMDSWTLQTGYP 502
                           :||              |||.....:..||..|..:..:.||..::|...
  Fly   502 FIDTDKKDKLSAVDWDLWLKSEGMPPVIPNFDESLANVTKELASLWSSKSVAELADSAEIKTTIS 566

  Fly   503 V-----------------------INVTRD-YAARTAKLNQERYLLNTQVARA 531
            :                       ||:... |..:::|..:.|:.||..:.||
  Fly   567 IHQLIDFLGKLIESKDIVDLNEGKINLLESTYNLKSSKNAEVRFRLNRLIIRA 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP1029NP_001263065.1 Peptidase_M1 33..431 CDD:279741 105/408 (26%)
M1_APN_2 43..502 CDD:189008 133/518 (26%)
ERAP1_C 583..908 CDD:288671
CG10602NP_609916.5 Ribosomal_L13 16..>50 CDD:294238
leuko_A4_hydro 79..681 CDD:274120 142/573 (25%)
M1_LTA4H 79..520 CDD:189006 123/472 (26%)
Leuk-A4-hydro_C 541..680 CDD:286244 15/79 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.