DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Aplip1 and NUMBL

DIOPT Version :9

Sequence 1:	NP_728573.1	Gene:	Aplip1 / 53472	FlyBaseID:	FBgn0040281	Length:	490	Species:	Drosophila melanogaster
Sequence 2:	NP_004747.1	Gene:	NUMBL / 9253	HGNCID:	8061	Length:	609	Species:	Homo sapiens

Alignment Length:	121	Identity:	39/121 - (32%)
Similarity:	56/121 - (46%)	Gaps:	13/121 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   351 YLGSVETLAHKGTGVVCQAVRKIVGEYGNSPTGQTCILEVSDQGLRMVDRSGPNQNKKDKKPCID 415
            |||.||....:|..|...||:|:......|...   :|.||..|||:||       .|.|...:|
Human    84 YLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKS---VLWVSADGLRVVD-------DKTKDLLVD 138

  Fly   416 YFYSLKNVSFCAFHPRDHRFIGFITKHPTVQRFACHVFKG-SESTRPVAEAVGRAF 470
              .:::.|||||......:...:|.:..|.:|:.||.|.. .:|...::.|||.||
Human   139 --QTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAF 192

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Aplip1	NP_728573.1	SH3_JIP1_like	275..329	CDD:212735
Aplip1	NP_728573.1	PTB_JIP	343..490	CDD:269923	39/121 (32%)
NUMBL	NP_004747.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..68
		PTB_Numb	64..198	CDD:241298	39/121 (32%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	223..283
		NumbF	287..371	CDD:283874
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	372..421
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	434..464
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	537..609
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165141116
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.840