DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and NUMBL

DIOPT Version :10

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_004747.1 Gene:NUMBL / 9253 HGNCID:8061 Length:609 Species:Homo sapiens


Alignment Length:121 Identity:39/121 - (32%)
Similarity:56/121 - (46%) Gaps:13/121 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 YLGSVETLAHKGTGVVCQAVRKIVGEYGNSPTGQTCILEVSDQGLRMVDRSGPNQNKKDKKPCID 415
            |||.||....:|..|...||:|:......|...   :|.||..|||:||       .|.|...:|
Human    84 YLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKS---VLWVSADGLRVVD-------DKTKDLLVD 138

  Fly   416 YFYSLKNVSFCAFHPRDHRFIGFITKHPTVQRFACHVFKG-SESTRPVAEAVGRAF 470
              .:::.|||||......:...:|.:..|.:|:.||.|.. .:|...::.|||.||
Human   139 --QTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCAF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735
PTB_JIP 343..490 CDD:269923 39/121 (32%)
NUMBLNP_004747.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..68
PTB_Numb 64..198 CDD:241298 39/121 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..283
NumbF 287..371 CDD:461874
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 372..421
PRK12323 <394..584 CDD:481241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..464
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 537..609
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.