DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and dab1a

DIOPT Version :10

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_009292841.1 Gene:dab1a / 692351 ZFINID:ZDB-GENE-060528-1 Length:597 Species:Danio rerio


Alignment Length:134 Identity:30/134 - (22%)
Similarity:56/134 - (41%) Gaps:15/134 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 RYLLGYLGSVETLAHKGTGVVCQAVRKIVGEYGNSPT----GQTCILEVSDQGLRMVDRSGPNQN 406
            ||....:|..|..|.:|..:...::.|:.|...::.:    .|...|.||..|:::.|       
Zfish    41 RYKAKLIGIDEVTAARGDKLCQDSMMKLKGIAASARSKGEHKQKVFLTVSFGGIKIFD------- 98

  Fly   407 KKDKKPCIDYFYSLKNVSFCAFHPRDHRFIGFITKHPTVQRFACHVFKGSESTRPVAEAVGRAFQ 471
              :|...:.:.:::..:|:.|....|||..|::.......||.  ..|.::|..||...:...||
Zfish    99 --EKSGVLQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFV--AIKTAQSAEPVILDLRDLFQ 159

  Fly   472 RFYQ 475
            ..|:
Zfish   160 LIYE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735
PTB_JIP 343..490 CDD:269923 30/134 (22%)
dab1aXP_009292841.1 PTB_Dab 25..174 CDD:269926 30/134 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.