DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and dab1b

DIOPT Version :9

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_005171167.1 Gene:dab1b / 678641 ZFINID:ZDB-GENE-060421-7958 Length:520 Species:Danio rerio


Alignment Length:172 Identity:39/172 - (22%)
Similarity:70/172 - (40%) Gaps:32/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 IYVQKEAEDLWCEGVNLRTGRQGIFPSAYAVDLDYNEFDPTVQLVKKE--RYLLGYLGSVETLAH 360
            :.|:||:.         |.||..:|.   ....|.:| ...:|..:.:  ||....:|..:..|.
Zfish    13 VTVKKESR---------RRGRFSVFT---VTGQDRSE-QALIQRYRGDGIRYKAKLIGIDDVTAT 64

  Fly   361 KGTGVVCQAVRKIVGEYGNSPT----GQTCILEVSDQGLRMVD-RSGPNQNKKDKKPCIDYFYSL 420
            :|..:...::.|:.|...::.:    .|...|.||..|:::.| |||          .:.:.:|:
Zfish    65 RGDKLCQDSMMKLKGIAASARSKGKHKQRIFLTVSFGGIKIYDERSG----------VLQHHHSV 119

  Fly   421 KNVSFCAFHPRDHRFIGFITKHPTVQRFACHVFKGSESTRPV 462
            ..:|:.|...||||..|::.......:|.  ..|.|.:..||
Zfish   120 HEISYIAKDSRDHRAFGYVCGKKGNHKFV--AIKTSHAAAPV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735 7/30 (23%)
PTB_JIP 343..490 CDD:269923 29/127 (23%)
dab1bXP_005171167.1 PTB_Dab 34..182 CDD:269926 32/139 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574001
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.