DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and Fam43b

DIOPT Version :9

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001075141.1 Gene:Fam43b / 625638 MGIID:3651622 Length:330 Species:Mus musculus


Alignment Length:169 Identity:44/169 - (26%)
Similarity:67/169 - (39%) Gaps:25/169 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 RTGRQGIFPSAYAVDLDYNEFDPTVQLVKKERYLLGYLGSVETLAHKGTGVVCQAVRKIVGEYGN 379
            |.||  :|.|. ...::.|:.|||        |.:.|||:..||..||.|....||.:|....| 
Mouse    51 RLGR--VFRSR-RQKVELNKEDPT--------YTVWYLGNAVTLHAKGDGCTDDAVGRIWARCG- 103

  Fly   380 SPTGQTCI-LEVSDQGLRMVDRSGPNQNKKDKKPCIDYFYSLKNVSFCAFHPRDHRFIGFITKHP 443
             |.|.|.: |.:...|:||......:.....::|.  :.|.|..:::||...|..|...::.:|.
Mouse   104 -PGGGTKMKLTLGPHGIRMQPSERSSGASGGRRPA--HAYLLPRITYCAADGRHPRVFTWVYRHQ 165

  Fly   444 TVQR---FACH------VFKGSESTRPVAEAVGRAFQRF 473
            ...:   ..||      ..|.....|.:.:....||..|
Mouse   166 ARHKAVVLRCHAVLLARAHKARSLARLLHQTALAAFSDF 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735 5/13 (38%)
PTB_JIP 343..490 CDD:269923 35/141 (25%)
Fam43bNP_001075141.1 PID_2 71..263 CDD:258856 36/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.