DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and nos1apa

DIOPT Version :10

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_021332861.1 Gene:nos1apa / 553539 ZFINID:ZDB-GENE-081024-1 Length:505 Species:Danio rerio


Alignment Length:160 Identity:35/160 - (21%)
Similarity:62/160 - (38%) Gaps:37/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 DPTVQLVKKERYLLG------YLGSVETLAHKGTGVVCQAVRKIVGEY--GNSPTGQTCILEVSD 392
            |..:.|..:|.:..|      |:||::.........:..|:|:|..|:  .|....:..|: ||.
Zfish    15 DLRIPLHNEEAFQHGINFEAKYIGSLDVARPNSRVEIVAAMRRIRYEFKVKNIKKKKVNII-VSV 78

  Fly   393 QGLRMVDRSGPNQNKKDKK--------------PCIDYFYSLKNVSFCAFHPRDHRFIGFITKHP 443
            .|:::..|     .||.||              |....||       .:...:|.:...:|.:..
Zfish    79 DGVKVALR-----KKKKKKEWTWDESKMMVMQDPIYRIFY-------VSHDSQDLKIFSYIARDG 131

  Fly   444 TVQRFACHVFKGSESTRP--VAEAVGRAFQ 471
            ....|.|:|||..:.::.  :...||:||:
Zfish   132 QSNVFRCNVFKSKKKSQAMRIVRTVGQAFE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735
PTB_JIP 343..490 CDD:269923 33/153 (22%)
nos1apaXP_021332861.1 PTB_CAPON-like 2..180 CDD:269968 35/160 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.