DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and ldlrap1

DIOPT Version :9

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001017114.1 Gene:ldlrap1 / 549868 XenbaseID:XB-GENE-954261 Length:309 Species:Xenopus tropicalis


Alignment Length:153 Identity:39/153 - (25%)
Similarity:66/153 - (43%) Gaps:17/153 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 LDYNEFDPTVQLVKKERYLLGYLGSVETLAHKGTGVVCQAVRKIVG-EYGNSPTGQTCILEVSDQ 393
            |..|..|....|::...:.|.|||.......||..:...||::||. ...:....|..||:||.:
 Frog    30 LPENWTDTRETLLEGMSFHLKYLGMTLVEQPKGEELSATAVKRIVATAKASGKKLQKVILKVSPR 94

  Fly   394 GLRMVDRSGPNQNKKDKKPCIDYFYSLKNVSFCAFHPRDHRFIGFITKHPTVQRFACHVF----- 453
            |:.:.|.:. ||..::        .|:..:|:|.......:...:|.:....:...||.|     
 Frog    95 GIILYDLAS-NQLIEN--------VSIYRISYCTADKMHDKVFAYIAQSQQNETLECHAFLCTKR 150

  Fly   454 KGSES-TRPVAEAVGRAFQRFYQ 475
            |.::: |..||:|...||: |:|
 Frog   151 KMAQAVTLTVAQAFKVAFE-FWQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735
PTB_JIP 343..490 CDD:269923 35/140 (25%)
ldlrap1NP_001017114.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 31/130 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.