DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and Ldlrap1

DIOPT Version :10

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001102741.1 Gene:Ldlrap1 / 500564 RGDID:1563417 Length:307 Species:Rattus norvegicus


Alignment Length:154 Identity:38/154 - (24%)
Similarity:65/154 - (42%) Gaps:19/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 LDYNEFDPTVQLVKKERYLLGYLGSVETLAHKGTGVVCQAVRKIVG-EYGNSPTGQTCILEVSDQ 393
            |..|..|....|::...:.|.|||.......||..:...||::||. ...:....|...|:||.:
  Rat    30 LPENWTDTRETLLEGMVFSLKYLGMTLVERPKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPR 94

  Fly   394 GLRMVDRSGPNQNKKDKKPCIDYFYSLKNVSFCAFHPRDHRFIGFITKHPTVQRFACHVFKGSES 458
            |:.:.| |..:|..::        .|:..:|:|.......:...:|.:....:...||.|..:: 
  Rat    95 GIILTD-SLTSQLIEN--------VSIYRISYCTADKMHDKVFAYIAQSQQNESLECHAFLCTK- 149

  Fly   459 TRPVAEA----VGRAFQ---RFYQ 475
             |.||:|    |.:||:   .|:|
  Rat   150 -RKVAQAVTLTVAQAFKVAFEFWQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735
PTB_JIP 343..490 CDD:269923 34/141 (24%)
Ldlrap1NP_001102741.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 31/132 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..205
Clathrin box. /evidence=ECO:0000250|UniProtKB:Q5SW96 211..215
AP-2 complex binding. /evidence=ECO:0000250|UniProtKB:Q5SW96 248..275
[DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. /evidence=ECO:0000250|UniProtKB:Q5SW96 256..265
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.