DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Aplip1 and numbl

DIOPT Version :9

Sequence 1:NP_728573.1 Gene:Aplip1 / 53472 FlyBaseID:FBgn0040281 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_005173435.1 Gene:numbl / 497616 ZFINID:ZDB-GENE-051113-340 Length:640 Species:Danio rerio


Alignment Length:137 Identity:41/137 - (29%)
Similarity:66/137 - (48%) Gaps:21/137 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 QLVKKER--YLLGYLGSVETLAHKGTGVVCQAVRKIVGEYGNSPTGQ---TCILEVSDQGLRMVD 399
            :.|:|.:  :.:.|||.||....:|..|..:||:|:      ..:|:   ..:|.||..|||:||
Zfish    52 EAVRKGKCNFPVRYLGLVEVDESRGMHVCEEAVKKL------KVSGKKTVKAVLWVSADGLRVVD 110

  Fly   400 RSGPNQNKKDKKPCIDYFYSLKNVSFCAFHPRDHRFIGFITKHPTVQRFACHVFKG-SESTRPVA 463
                   .|.|...:|  .:::.|||||......:...:|.:..|.:|:.||.|.. .:|...::
Zfish   111 -------DKTKDLIVD--QTIEKVSFCAPDRNYDKAFSYICRDGTTRRWMCHCFMALKDSGERLS 166

  Fly   464 EAVGRAF 470
            .|||.||
Zfish   167 HAVGCAF 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Aplip1NP_728573.1 SH3_JIP1_like 275..329 CDD:212735
PTB_JIP 343..490 CDD:269923 40/134 (30%)
numblXP_005173435.1 PTB_Numb 45..179 CDD:241298 41/137 (30%)
NumbF 260..344 CDD:283874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.